KEGG   Drosophila willistoni: Dwil_GK22608Help
Entry
Dwil_GK22608      CDS       T01067                                 

Definition
GK22608 gene product from transcript GK22608-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dwi  Drosophila willistoni
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dwi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 594 aa AA seqDB search
MKVFCIQFVLLVFSQSLLRAPDLTSAATLQPPPLIQTLSDGGDIGPQFNLEQSSETPQVI
VVEDAKFWHNVGMRQLKKTIDNAKKAKEYSYANKAKNIIVFVGDGMGIATISAGRIYKGQ
YLKHGNGEEETLIFDDFPNTGMAKTYNVDKQVPDSAGTATAMFTGVKTDYGAIGVDSTRS
ELNAEQGRVESIMDWAQRAGKRTGIVTTTRITHATPASTYAHIYDRDWECDTEVPAQSVG
IHVDIARQLVENAPGNKFNVILGGGRKPMGALNPQEVQTVKFEGPTETICARNDQRNLPK
EWLQKHANDSVPAALVHSREELLKVDVKQVDHLMGLFRNNHITYSIARQAGEPSLQDMTE
AAIGVLERGQTSSGYVLLVEGGRIDQGHHMNYARAALHEVYEFDLAIQAALNNTNPEETL
ILVTADHSHAVTFNGYPLRGNDILGSANLHKAKDPMVYETITYANGPGYFEHLANETRPA
NSSNVWKPLNLFTQEERTSPTYRNLAAFALKDETHGGEDVAVFAHGPGSNLVRGVFEQNY
LAYVVSYAGCIGPAKDFDGSCSRGYAASPGDKITGSVSLLVAAIVSLLVAAPAT
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgttttgcattcaatttgtattattggtgtttagccaaagccttcttagggca
cctgatctgacctcggcggccactcttcagccgccgcccttaattcaaactctgagtgat
ggcggcgatattggaccacaattcaatttggagcaatcatcggagacaccacaagttata
gtagtagaagatgccaagttctggcacaatgtaggcatgcggcagttaaaaaaaaccatt
gataatgccaagaaggccaaggaatactcttatgctaacaaggccaagaacattattgta
tttgtcggagatggcatgggcatagctacaataagtgccggaagaatttacaagggtcaa
tacttaaagcatggaaatggcgaggaggagacactgatctttgatgatttcccgaatacg
ggaatggctaagacctacaatgtggataaacaagtaccagattcagcgggcactgccacg
gccatgtttacgggcgtgaaaacggactacggagccattggcgtggactctactcgttcg
gagttgaatgctgaacagggtcgggtggaatccattatggattgggcccagcgtgcgggt
aaacgaacgggaattgttaccactaccagaattacacatgccacgcctgcctcaacctat
gcgcatatatatgatcgggactgggaatgcgatacggaggtgccagcacaatcggtggga
atacatgtggatattgcacggcagctggtggagaatgcacctggcaataagttcaatgtc
atactcggtggtggacgaaaacccatgggagcattaaatccacaagaggttcaaacagtg
aaattcgaagggcctacggagacaatttgtgctagaaacgatcagcgaaacttgcccaaa
gagtggttacaaaaacatgccaacgatagtgtgccagctgcgctggttcactcacgcgag
gagctactgaaggtggatgtgaagcaagtcgatcacttgatgggcttgttcagaaacaat
catatcacatactcaattgcacgtcaggctggtgagccctcgctgcaggatatgactgaa
gcggccattggtgtacttgagcgtggacaaacatcgtcgggctatgtgctccttgtcgag
ggtggacgcattgatcagggtcatcatatgaactatgcgcgagcagctctacatgaagtc
tacgaattcgatttggccattcaggcagctctcaataatacgaatcccgaggaaacactt
atactggtcacagctgatcattcccatgctgtgaccttcaatggttatcccttgagaggc
aacgatatcttgggttcggccaatttgcataaggccaaagatccaatggtttatgaaacg
attacatatgccaatggaccgggttactttgaacatttggccaatgaaacgcgtcccgcc
aacagctcaaatgtttggaaacccttaaatcttttcacccaagaggagagaacttctccc
acctaccgtaatttggctgcttttgccctgaaagacgagactcatggtggcgaggatgtg
gctgtctttgctcatggcccaggctccaatttggttcgcggtgtctttgagcaaaattat
ttggcctatgtggtcagctatgctggatgcattggacccgctaaagatttcgatggatcc
tgtagtcgaggttatgcagcctcgcctggcgacaagataactggtagtgtaagccttttg
gtagctgccatagtctcactcctggttgctgcaccggctacatag

DBGET integrated database retrieval system