KEGG   Drosophila willistoni: Dwil_GK22674Help
Entry
Dwil_GK22674      CDS       T01067                                 

Definition
GK22674 gene product from transcript GK22674-RA
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
dwi  Drosophila willistoni
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    Dwil_GK22674
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dwil_GK22674
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dwil_GK22674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1112 aa AA seqDB search
MHEYDIIERKEEQDSLPTNTKDSNYNSNNTNKRIDQNTQDPQDQDQDRVKEESRKASSSS
ISPSQRTLYPFVVEYIDQVVQTIEIDPATSSVEGADTPPKPKRKRRVYITDSGRSYNLRP
RGQEVAVTAVQTEASGTQAAKEKDQSPPLAPQTQIASPTPTEATEFLHPDHFKPEIWNII
EEEQDNTKALGKKKRGIRGIRKRRNQLLTEIYSPETEAAIAAAQLELDATAKSNSRVGRK
RTCTMSLYDRRYQTAGDERRVANGYGGNGLRAGPSASTNEIESQDMQGHQYYGSSGSSAT
PGLNGSAAINNHAPAMGTLCNIGNTCYLNSVVYTLRFAPHFLHNLHHLIHDLNVVQQTIM
RQHTAKSASLGRHVSGGGGVAQLEHARSWSSKDLVTTEPPYGISNSNGNVSVNSNSTSCT
SASSNTSKSSHQSVSEKLHELYHNLHGNEMTDSTEPYHADTLLHAIQDVNATFEGNQQQD
AHEFLMCVLNCIRETNQSLIKAIGECPEVMAHGYISNPDEVDSNDAGQERMDSSVTISGN
GTASQATAIAPAVPTPAAVATTTTKTSFFSRKSKRKDDLKSSGSSKSSSTRVQSPLKEQS
PTAGSATSNSLFYLNTVDLTGATPPPSSLSSSSTSPPLPLLPTTAAAPTKYTSDDEMNSS
SLLKEKMRLEERIRELNLNFFSADFEGIVVLTTKCLSCETVTRQKQGMLDISVPVPISGY
DNAELQEKPSAYIQNSCITKEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRF
SGGMEKVSTYVPTTFTLPCFCVKCCELNDGNKLHVYKLYSVITHVGATLTVGHYIAYTCF
LDLASDYLNCPKDRRNNMTQQHTTSALAATGTGMGSNENAAPNNGQSSSITPVSAAASAL
ASSGTSLMKKMKFGRSKASSSGDMSKNVKQLNGISSKTITNGIGKLTMNTTCHGVNCCAM
RLCCSQQTSAAGSCSDFSEECLQNGSNSNLSYSSSQATNVGGGGGGTAYPPGYGSTGRGG
VKANYPHGSTEPIWYMCDDDKIKAMTQREFEELLSPTRKITITPYLLFYARFDLQSTSSS
TSATPSKPGASAASTPPSSQSSWSTDNGAHKI
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaatatgacataatagagcgcaaagaggaacaagacagtcttccaactaacaca
aaggatagcaattacaacagcaacaatacaaataaacgcattgatcagaatacacaagat
ccacaggatcaggatcaggatagagtgaaagaagagagcagaaaagcatcatcatcatcc
atatcgccatcccagaggactctttatccatttgttgtggaatacatcgatcaggttgta
caaactattgaaatcgatccggcaacatcttctgtagaaggagctgatactcctccaaaa
ccaaaacgaaagcgtcgtgtctatattacggactctgggcgttcttataacctaagacca
cgaggccaagaggtagcagtaacagcggttcaaacggaggcgtctgggacacaggctgct
aaagaaaaggatcaaagtccaccgttggcaccacagacgcagattgcctcccccacacca
acagaggccacagagttcttacatccagatcactttaaaccagagatttggaatatcatc
gaagaagaacaggacaacacaaaggcattgggcaaaaagaagcggggtattcgaggcatt
cgaaagcgaagaaaccaactcctcactgaaatctattcacctgaaaccgaagcggcaatt
gcagcagctcaactcgaattagacgcgactgccaaatcgaattcccgtgtcggccgcaaa
agaacctgcaccatgtcattgtatgatcgtcgttaccagactgccggagatgagcggcgt
gtcgccaatggttatggcggtaatggtttacgtgctggtccctcagcctcaaccaatgaa
attgaatcgcaggatatgcagggtcatcagtattacggatcatctggaagctcagcgaca
ccaggattaaatggcagtgcagccataaacaatcatgccccggccatgggtaccttgtgc
aacattggcaacacatgctatctcaattcggtggtatataccctacgttttgctccccac
ttcctgcataatcttcatcatctgatacacgatctgaatgtggtacaacagaccataatg
cgtcagcacacggccaaatccgcttcgttgggtcggcatgtgagtggaggcggtggtgtt
gctcaattggagcacgcccgtagttggagcagtaaggatttggtcacaacggaaccaccc
tacggcattagcaacagcaatgggaatgtcagtgtcaatagcaatagtacaagttgcaca
agcgcgagctcaaatactagtaaatcgagtcatcagtcagtgagcgagaagcttcacgag
ctgtatcacaatctgcatggcaatgagatgaccgattcgacggaaccgtatcatgcggat
actctactgcatgccatacaggatgtgaatgccacctttgagggtaatcaacagcaggat
gcccacgagtttctaatgtgtgtgctcaattgcatacgcgagacaaatcaatcgctaatc
aaggccattggtgagtgtcccgaggtaatggcgcatggttacatatccaatcccgatgag
gtggattccaatgatgctggccaggagcgcatggattcttcggtcaccatctctggcaat
ggaacggctagtcaagcaacagcaattgctcctgcagtcccaacaccagcagctgtagca
actacaacaacaaaaacatcattcttttcacgcaaatcgaagagaaaagacgatttaaaa
tcgtccggctcgagcaagtcatcatcgacgcgtgtccagtcaccattaaaggagcaaagt
cccacggctggctcggccacatccaatagtctattttatttaaatacagtcgatctcact
ggggcaacaccaccaccatcatcgttgtcgtcgtcgtcaacgtctcctccgttgccgctc
ctgccgacaacagcagcagcacccacaaaatacaccagtgacgatgagatgaacagcagt
agcctgctcaaggaaaaaatgcgcctcgaggagcgtatacgtgaattgaatttaaatttc
ttcagtgccgactttgagggcatagtggtgctgaccaccaagtgcctgagctgtgaaaca
gtgacccggcaaaagcagggcatgctagacatttcggttcctgtgcccatatcgggttac
gacaatgccgaactgcaggagaagccaagcgcttatatacagaactcttgcatcacaaag
gaatattttcgcggagagaacaaatatagttgtaatcagtgtactggctacacagaagcc
atacgctccatatcgtatgaggtgctgccgcgacttttggttatacaattgaatcgcttt
tcaggcggcatggaaaaagtcagcacctatgtcccgaccacattcacattgccctgcttc
tgtgtcaagtgctgtgaattgaatgatggcaacaagcttcatgtctacaagctctacagt
gtgattacccatgtgggagccacgctgacagtgggtcactatatagcctacacatgtttc
ctggatttggccagtgactatttgaattgtcccaaggatcgacgcaataacatgacgcag
cagcacaccactagtgcattggcagcaaccggaacaggaatgggctccaatgagaatgca
gctccgaataatggacaaagtagcagcatcactccagtgtcagctgctgcctcggctctg
gcctcctcaggcactagtctgatgaagaaaatgaagttcggacgcagcaaggcgtcgagc
agcggcgacatgagcaaaaatgtaaagcaattgaatggcattagcagtaagacgattacc
aatggcattggcaaactcaccatgaataccacatgtcatggagtcaactgctgtgccatg
cgtctgtgctgcagccagcagaccagtgcagccggcagttgcagcgacttcagtgaggag
tgcctgcaaaatggtagcaatagcaatctcagttacagcagttcacaggcaacaaatgtt
ggtggtggcggtggtggcaccgcctatccaccgggatatggaagcacaggacgcggcggt
gtcaaggctaactatccacacgggagcacagagccaatttggtatatgtgcgatgatgac
aagatcaaggctatgacgcagcgggaattcgaagagctattgtcacccacacggaaaata
accattacaccatatttgttattctatgcacgattcgatctgcaatcgacatcgtcgtcg
acatcggcaacgccatcgaagccaggagcatcagcagcatcaacgccgccatcgtcacag
agctcctggtccactgataatggagcgcacaaaatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system