KEGG   Drosophila willistoni: Dwil_GK22772Help
Entry
Dwil_GK22772      CDS       T01067                                 

Gene name
Dwil_Ace
Definition
GK22772 gene product from transcript GK22772-RA
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
dwi  Drosophila willistoni
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dwil_GK22772 (Dwil_Ace)
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     Dwil_GK22772 (Dwil_Ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 640 aa AA seqDB search
MAFTSLSPQSLGAIAMLVLSLHLSNANVIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIP
YAKPPVDDLRFRKPVPAEPWHGVLDATRLSATCVQERYEYFPGFSGEEIWNPNTNVSEDC
LYINVWAPAKARLRHGRGANGGEHSGNKQGDTDHLIHNGNPQNITNGLPILIWIYGGGFM
TGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLSPEMPDEFSEEAPGNVGLWDQAL
AIRWIKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGVVKRGMMQSGTMNAPWSH
MTSEKAVEIGKALINDCNCNASMLKTNPSHVMSCMRAVDAKTISVQQWNSYSGILSFPSA
PTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKY
LEIMNNIFGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAE
RGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNTSLQYRPVERELGKRMLNSV
IEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSFWNDYLPKVRSW
TGTGCEGNSASASISPRHLQLLGLAALLYICSAFRIEGIF
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggccttcactagcctcagcccccaatcattgggtgccatcgcgatgctcgtgctgtcg
ctgcacttgtccaatgcaaacgtcatcgatcgacttgtggtacagacatcatcgggaccc
gtgcgcggtcgctcggtaacggtccaggggcgtgaggttcacgtatatacgggcataccg
tatgccaagccgcccgtcgacgacctgcgctttcgcaagccggttccggcggaaccctgg
cacggtgtattggatgccacgcgtctgtcggcgacctgcgtgcaagagcgttatgaatac
tttcctggattttcgggcgaagaaatatggaatccaaataccaatgtatcagaagattgc
ctctatataaacgtttgggcaccggccaaggcacgtttgcgtcatggacgcggagccaat
ggtggcgagcattcgggcaacaagcagggcgatacggaccatctcattcataatggcaat
ccgcagaatatcaccaatgggttacccatattgatttggatctatggtggcggatttatg
accggctcggccactctggatatctacaatgccgacattatggcagctgtgggcaatgtg
attgtggcctcgtttcagtatcgtgtgggtgcatttggttttctgcacttgtcccccgaa
atgcccgatgaatttagcgaggaggcgccaggcaacgttggtctctgggatcaggcactg
gccatacgttggattaaggataatgcccatgcatttggcggcaatcccgaatggatgaca
ctgtttggtgaatcggccggttcgagttcggtgaatgcacagctcatgtcgccggttaca
aggggcgtggttaaacgtggcatgatgcagtcgggcaccatgaatgcaccttggagccac
atgacttccgaaaaggcagttgagattggcaaagcgctcatcaatgactgcaactgcaat
gcatctatgctaaagaccaatccttctcatgtgatgagctgtatgcgtgccgtggatgcc
aagactatatcggtgcagcaatggaactcgtactcaggaatactcagtttcccgtcggcg
ccaaccatagatggtgcatttttgccagctgatcccatgactctaatgaagacggccgat
ctcaaggattacgatatcctcatgggcaatgtgagggatgagggcacatactttttgctg
tacgatttcatcgattacttcgataaggacgatgccaccgccttgccgcgtgacaagtat
ctggaaattatgaacaacatttttggcaaggcaacgcaggcagaacgcgaggccataata
tttcagtataccagctgggagggcaatccaggctatcaaaatcaacagcaaattggacgc
gctgtgggcgatcatttctttacatgccccaccaatgagtatgcccaagctttggccgag
cgaggcgcctccgtgcactattattactttacacaccgcacaagcacctcgctgtggggc
gaatggatgggcgttctgcacggcgatgagattgagtacttctttggccagccgctaaac
acatctctgcagtatcgacctgtggagcgtgagctgggcaagcgtatgcttaattcggtc
atcgaattcgccaagaccggcaatcccgcacaggatggcgaagaatggccaaacttttcc
aaggaggatcctgtctattacatctttagtacagatgataaaatcgaaaaactggcacgt
ggtcctttagcggcccgttgttcattctggaacgactatttgcccaaagtcaggagttgg
accggtacaggctgcgaaggcaattcggcaagtgcttccatatcacctagacacctgcag
cttctgggattggctgccctgctatatatctgtagtgcattccgtatcgagggaattttc
taa

DBGET integrated database retrieval system