KEGG   Drosophila willistoni: Dwil_GK23361Help
Entry
Dwil_GK23361      CDS       T01067                                 

Definition
(RefSeq) GK23361 gene product from transcript GK23361-RB
Organism
dwi  Drosophila willistoni
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 163 aa AA seqDB search
MAEGNIAPATCSEGGAPLSAPHSNAEVIRGQIFEVGPRYSKLTYIGEGAYGMVVSADDTM
TNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIEQMRDVYIVQC
LMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRD
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggaaacattgctcctgctacatgttccgagggcggtgctcctcttagcgcc
ccacactccaacgctgaagtaataagggggcaaatttttgaggtgggacccagatatagt
aaacttacatacattggcgaaggagcttatggcatggttgtatctgctgatgatacgatg
acaaaccaaagagttgcaatcaaaaaaatttctccgtttgaacaccagacatattgccaa
cgtacgctgagagagataaccattttaactcggtttaaacatgaaaatataattgatata
cgcgacatcttaagagtagatagcatagagcagatgagggatgtgtacattgtacaatgc
ttaatggagactgatctatataaactactcaaaacgcagaggttaagcaatgaccacata
tgctacttcttgtatcagatactacgaggattaaagtatatacactcagcaaatgtttta
caccgcgac

DBGET integrated database retrieval system