KEGG   Drosophila willistoni: Dwil_GK23480Help
Entry
Dwil_GK23480      CDS       T01067                                 

Definition
GK23480 gene product from transcript GK23480-RA
Orthology
K11252  
histone H2B
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaaaaactagtggaaaagcagccaagaaggctggcaaggctcaaaagaacatc
accaagaatgacaaaaagaagaagcgcaagcgtaaggagagctatgctatttacatttac
aaagtgttaaagcaagtccacccagacactggtatttcttcaaaagcaatgagcataatg
aatagctttgtaaacgatatttttgaacgtattgctgctgaggcctcccgcttggcccac
tacaataagaggtcgaccatcaccagtcgcgaaatccaaacggctgttcgtttgcttttg
ccgggtgagcttgctaagcacgctgttagtgagggaacaaaagctgtcaccaagtatacc
agctcaaaataa

DBGET integrated database retrieval system