KEGG   Drosophila willistoni: Dwil_GK23812Help
Entry
Dwil_GK23812      CDS       T01067                                 

Definition
GK23812 gene product from transcript GK23812-RA
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dwi  Drosophila willistoni
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dwil_GK23812
   01212 Fatty acid metabolism
    Dwil_GK23812
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dwil_GK23812
   00650 Butanoate metabolism
    Dwil_GK23812
  Lipid metabolism
   00062 Fatty acid elongation
    Dwil_GK23812
   00071 Fatty acid degradation
    Dwil_GK23812
   01040 Biosynthesis of unsaturated fatty acids
    Dwil_GK23812
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dwil_GK23812
   00310 Lysine degradation
    Dwil_GK23812
   00380 Tryptophan metabolism
    Dwil_GK23812
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dwil_GK23812
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     Dwil_GK23812
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dwil_GK23812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 796 aa AA seqDB search
MSATRLLSAIGQVSRHQLLQNRCARAFPAAAAQLYRQQSPRLMSTQTAANPSPAAAAGAN
KHLHTKVVNGVLVIKFDSPNVKVNSLGSEVSDEFERVIKDLETNPSVNSAVLISGKPGCF
VAGADIGMLEACQTAEEATLISHGAQLMFERMERSRKPIVAAINGVCLGGGLELALACHY
RIATKDNKTKLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDLELTGKQVRADRAKRLGIV
DLLVDPLGPGLQPAEQNTIEYLEKTAVKVAQDLASGKLRVNREKSGLVNKLQALVMDTDF
VKNKIFDTARKQVMKASGGLYPAPLKILDVIRAGVDKGQEAGYEAERKGFGALSATPESK
GLISLFRGQTECKKNRFGKPQQAVKTVGVLGAGLMGAGIVQVSVDKGYKVVMKDATDAGL
GRGIGQVQKGLETAVKRKRISALERDQTLAQLVPTLDYNDFKNADIVIEAVFENIDIKHR
VIKELEAVVPAHCVIATNTSAIPITKIAAGSSRPEKVVGMHYFSPVDKMQLLEIITHPGT
SKDTVAQAVAVGLKQGKVVITVGDGPGFYTTRILATMLSEAIRLLQEGVDPKELDQYTKK
FGFPVGAATLADEVGIDVGSHIAVDLAKAFGDRFSGGNLEVMQDLVLAGFLGRKSGKGIF
LYDGQSKGGRPVNTSAVEIVKQKYSLVSKGANTPEDLTLRMVSRFINEAVLCLEEKILDS
PLEGDVGAVFGLGFPPFSGGPFRWVDQYGAGKLVSKMQSYADLYGAPFKPAQTLIDMAKD
PSKKFYPKATGGTSKL
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaacgagacttctgagtgccattggccaagtttctcggcatcaattattgcaa
aatcgctgtgctagagcttttcccgcagccgctgcccaactatatcgccagcaatcacca
cgtctaatgtccacccaaaccgctgccaatccctcaccagcagcagcagctggagccaac
aagcatttgcataccaaagtggtcaatggagtgctggtgattaaattcgattcacccaat
gtcaaggttaactctttgggttccgaagtaagcgatgaattcgagcgtgtcatcaaggat
ctggagacaaatcctagtgtcaattcggcggtattgatctccggcaagccaggatgcttt
gttgctggcgctgatattggcatgctggaagcctgccagacagccgaagaggccaccctc
atctcacatggtgcccaattaatgttcgagcggatggagcgtagccgcaaacccattgtg
gctgccatcaatggtgtttgtcttggcggtggtctggaattggctttagcctgtcattat
cgcattgccaccaaggataacaaaacaaaattgggtctcccggaggtgatgttgggtcta
ttgcctggcggcggtggcactgttcgtttgcccaagttgacatccgttcccaccgccttg
gacttggaattgactggcaaacaagtgcgtgccgatcgtgccaaacgtttgggcattgtt
gatcttctcgtggatcctttaggtcctggtctacagccagcagaacagaataccattgag
tatctggaaaagactgctgtgaaagtggcccaagatttggccagtggcaaattgcgtgtc
aatcgtgaaaaatctggtttggtcaataaactacaggctctggtcatggataccgatttt
gtgaagaacaaaatattcgataccgcccgcaagcaagtcatgaaggcttcaggtggcctc
tatccagcaccccttaagattctggatgtcattcgcgctggcgtggataagggccaggag
gctggttacgaggcagaacgtaaaggttttggtgccctctctgccacacccgagtccaaa
ggtttaatttctctattccgtggtcagactgaatgtaaaaagaatcgctttggcaagcca
cagcaagctgtaaaaactgttggcgttctgggtgccggattgatgggtgccggcattgtt
caggtctctgtggacaaaggctacaaggtggtaatgaaagatgccaccgatgcaggtctt
ggtcgtggcattggacaggtccagaaaggactggagactgctgtgaaacgcaaacgcatc
tcggctttggaacgtgatcaaactctagcccaactggttcccaccctcgattacaatgac
tttaaaaacgcggacattgtaatcgaagctgtattcgaaaatattgatattaaacatcgt
gtgatcaaggagctggaggctgttgtcccggcacattgtgttattgccaccaatacgagc
gcaattcccattaccaaaattgctgccggaagctcccgcccagagaaagttgtgggcatg
cattatttctcgccagtcgataagatgcaattgcttgaaattatcacacatcccggcacc
tcaaaggacacagtggctcaggcagtagccgttggtctgaagcaaggcaaggttgtgatc
acagtgggtgatggaccaggtttctataccacacgtatcctggccaccatgctgtcagag
gcgataagactgctgcaagaaggcgttgatccaaaggaattggatcagtacaccaaaaag
ttcggtttccctgtgggtgctgccacacttgcggatgaggttggcattgatgttggctct
cacattgctgtcgatttggccaaggcatttggcgaccgtttcagtggtggcaatttggaa
gtcatgcaggatttggttcttgccggtttcttgggacgcaaatcgggcaaaggcatcttc
ctctacgatggccaatccaagggtggccgtcctgtaaacacatccgccgttgagattgtc
aagcaaaagtatagcctggtctctaagggtgccaatacacccgaggatctgaccctgcgc
atggtttcacgtttcatcaacgaagccgtactctgtctggaggagaagattctcgatagt
ccactggagggagatgttggtgccgttttcggtctcggtttcccaccattctcgggcggt
cccttccgctgggttgatcaatacggtgctggtaaattggtcagcaaaatgcaatcatac
gctgacctctacggtgctcccttcaagccagcccaaactctaatcgatatggccaaggat
ccatcaaagaaattctatcccaaggctacaggtggtacatcgaaattataa

DBGET integrated database retrieval system