KEGG   Drosophila willistoni: Dwil_GK24219Help
Entry
Dwil_GK24219      CDS       T01067                                 

Definition
GK24219 gene product from transcript GK24219-RA
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
dwi  Drosophila willistoni
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dwil_GK24219
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    Dwil_GK24219
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dwil_GK24219
  Exosomal proteins of colorectal cancer cells
   Dwil_GK24219
  Exosomal proteins of bladder cancer cells
   Dwil_GK24219
Heparan sulfate/heparin binding proteins [BR:dwi00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  Dwil_GK24219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1057 aa AA seqDB search
MNWSRVLLIGLTALALTFVEIASLSLDPVASSELEQYIRKGDVVISTRHIRPRRKLHISI
EALFMIDFPMLKHKMSFFLDRKEQRVTLDISANGATESRNFEIPNINETSTIRSLALQFS
KNRITLYVDCKPSTHHDIEMSLTKLYTQMDDPVIKLFRERKYPLHFDADMEHSLQRANCQ
KGLHRRGNRRLLRNKITEREKNKKRDVRSNWYDEPTLSREGADQRQVEVPTDNERGDIPI
MHGDCEDALARSLSDLIALVKMLREDVAHQRQEIAYLRLLLENCAGCKEPHSSENLIRVD
CRTANPCYPGVDCHDSATGPRCGRCPVGFVGDGKACKPGVTCANFQCYPGVQCHDTVNGA
QCDSCPVGYDGDGRTCTLRNPCLDSPCPSGLECARMGFYPYFQCISCQKGQQINGTTCQD
VDECEIYRPCHDSAMCTNLNPGFRCGPCPPGMDGIHVHGYSADYLSVEFQKQTCEDIDEC
KMDLFRCPENSSCLNSIGSYSCPCHDGFVSDGPFSCLTAFDACQKLSNCSQNGECVLVDN
YKYECRCKVGWAGNGTLCASDRDLDGWPDQALDCVDTRCRQDNCPYLPNSGQEDADKDGF
GDGCDDDADGDQVFNKQDNCPFVYNIGQQDTDNDGVGDACDNCVSISNARQIDADNDGIG
NECDDDIDNDSILNQLDNCPLHSNQNQSDVDQDGVGDACDNCPTIPNPKQEDRDMNLVGD
ACHSIYDNDDDGVQDSKDNCPMVSNSDQLDTDHDGKGDVCDDDIDGDGIPNYRDNCPLAF
NANQTDINRNGKGDICEDDEDLDGTPNGIDNCPNNSMIHRTDFRTLRTILLDPVENSQAD
PHWEVHANGSEIVQTLNSDPGLAVGSDVFGGVDFEGTFHVTDMWDDDFVGFIFSFQSNRK
FYVVEWKKGFQTYWESRPFTAYGEPGIQIKLINSTSGPGPMMRNSLWHTGDTSGEAKLLW
HHPDKKGWTENTSYRWSLLHRPNIGLIRLRMYQGLDLVLDSGNVYDSTLKGGRLGVFCFS
QQMIIWSNLIYRCNNRVPHFAYDELPTNLKLKVDIDN
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgaattggtcgcgcgtgctgctaatcggcctgaccgcattggcgctgacattcgtggag
attgcatcactatcactggatccagttgcctcctccgaattggaacaatatatacgtaaa
ggtgatgttgttatatccaccagacatataagacctcgtcgcaagttacatatttccatt
gaggcactctttatgatcgattttcccatgctgaagcataaaatgtcatttttcttggat
cgcaaggagcaacgggtgacacttgatataagtgccaatggtgctacagaatcgcgtaat
ttcgaaatacccaatataaatgagacgagtactatacgatcgttggctcttcagttttcc
aagaatcgtattacattatatgtggattgtaagccaagtacacatcatgacatagaaatg
agtttaaccaaattatacacacaaatggatgatcctgtaattaaattgttccgtgagcgt
aaatatcctctgcactttgatgctgatatggaacattctttgcaaagagccaactgccag
aagggtctacatcggcggggtaacagacgcttgttgcgaaacaagatcactgaacgtgag
aagaacaagaaacgcgacgtacgcagcaattggtatgatgaacctactctgtctcgggaa
ggtgccgatcagcggcaagtggaggtgccaaccgacaatgaacgtggtgatatacccatc
atgcatggcgattgtgaagacgccctcgcacgttcgctgagcgatttaatagctttggtt
aagatgcttcgtgaagacgtcgcccaccaacgtcaggagattgcctacttgcgtttgtta
ttggagaattgtgccggctgcaaggagcctcacagcagtgaaaatcttatacgagtggat
tgtcgtacagcgaatccttgttatcctggcgtagattgtcatgattctgcaacgggtcca
aggtgtggccgttgtcctgtcggctttgttggtgacgggaaggcctgcaagccaggcgtc
acttgtgccaacttccaatgttatccaggcgttcagtgtcacgatactgtgaatggtgca
cagtgtgactcctgtccagttggctatgatggtgatggacgcacatgtacgctacgtaat
ccctgcctggattcaccatgcccctcaggtcttgaatgcgctcgaatgggtttctatcca
tacttccaatgcatctcctgccagaagggtcaacaaatcaatggaactacgtgtcaagat
gtggatgagtgtgaaatctatagaccctgtcatgacagtgcaatgtgtaccaatcttaat
cctggctttagatgtggtccatgtccacccggtatggatggtatacatgtgcatggctat
tctgcggactatttatctgtagaattccaaaagcaaacctgcgaggatattgacgaatgt
aaaatggaccttttcagatgtccggagaactcgtcctgtctgaatagcattggttcatat
agttgtccatgtcatgatggttttgtgagcgatggcccttttagctgtctaacagctttt
gatgcttgtcagaagctttccaattgctctcaaaatggcgaatgtgtgctggtggataat
tacaaatatgaatgtcgctgcaaagtgggatgggctggtaatggcacattgtgcgccagc
gatcgggatctcgacggctggccggatcaagcacttgactgtgtggacacgcgttgtcgt
caggataactgcccttatttgccgaattcaggacaggaagatgccgacaaagatggcttt
ggagatggctgcgacgatgatgccgatggtgatcaagtttttaataaacaggataattgt
ccatttgtatataacattggccagcaggacacggataatgatggagtaggagatgcctgc
gataattgcgtttctatatctaatgccaggcagatcgatgccgacaatgatggaattggc
aatgaatgtgatgacgacatagacaacgattccattttgaatcaacttgacaactgccct
ttgcacagtaatcagaatcaatccgatgtggatcaagatggtgtgggggatgcttgcgat
aattgtccaacaattcctaatcccaaacaggaggatcgtgacatgaacctggtgggcgac
gcctgccacagtatttatgacaatgacgacgatggcgttcaggattcgaaagacaattgt
ccgatggttagtaattctgaccagctagacacagatcatgatggtaaaggcgatgtctgt
gatgatgatatcgatggtgatggcattccaaactatcgggataattgtcctttagctttt
aatgctaatcaaacagatattaatcgcaatggaaaaggagacatatgcgaagatgatgaa
gatttagatggaacaccaaatggtatagacaattgccccaataactcgatgatacatcgc
acggatttccgtacattacgaacgattctattagatcctgtggaaaattcacaagccgat
ccgcattgggaggtgcatgcgaatggatcggagattgtccagacccttaactcagatcca
ggattggcagtgggcagcgatgtctttggtggagttgatttcgaagggacttttcatgtg
accgatatgtgggacgacgattttgtaggatttatattcagtttccaaagcaatagaaaa
ttctatgtggtcgaatggaagaagggctttcagacctactgggaaagtaggccattcaca
gcctacggcgagccgggcatacaaatcaaactgataaacagcacctcaggtcctggccct
atgatgagaaacagtttatggcatacgggcgatacgtctggagaggccaaacttctctgg
catcatcccgacaaaaaaggatggacagaaaatacctcatatcgttggtctcttcttcat
agacctaacattgggctaataagattaagaatgtatcaaggccttgacttggttttggac
tcgggaaatgtctacgattcaaccctgaaaggtggacgtttgggtgttttttgtttctcc
caacagatgataatatggtcgaatttgatctacagatgcaataaccgagtacctcatttc
gcctacgatgaattacccacaaatttgaagctgaaagttgatattgataactaa

DBGET integrated database retrieval system