KEGG   Drosophila willistoni: Dwil_GK24219Help
Entry
Dwil_GK24219      CDS       T01067                                 

Definition
(RefSeq) GK24219 gene product from transcript GK24219-RB
  KO
K04659  
thrombospondin 2/3/4/5
Organism
dwi  Drosophila willistoni
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dwil_GK24219
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    Dwil_GK24219
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dwil_GK24219
  Exosomal proteins of colorectal cancer cells
   Dwil_GK24219
  Exosomal proteins of bladder cancer cells
   Dwil_GK24219
Cell adhesion molecules and their ligands [BR:dwi04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Dwil_GK24219
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     Dwil_GK24219
   VNR
     Dwil_GK24219
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   Dwil_GK24219
Glycosaminoglycan binding proteins [BR:dwi00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   Dwil_GK24219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 419 aa AA seqDB search
MNWSRVLLIGLTALALTFVEIASLSLDPVASSELEQYIRKGDVVISTRHIRPRRKLHISI
EALFMIDFPMLKHKMSFFLDRKEQRVTLDISANGATESRNFEIPNINETSTIRSLALQFS
KNRITLYVDCKPSTHHDIEMSLTKLYTQMDDPVIKLFRERKYPLHFDADMEHSLQRANCQ
KGLHRRGNRRLLRNKITEREKNKKRDVRSNWYDEPTLSREGADQRQVEVPTDNERGDIPI
MHGDCEDALARSLSDLIALVKMLREDVAHQRQEIAYLRLLLENCAGCKEPHSSENLIRVD
CRTANPCYPGVDCHDSATGPRCGRCPVGFVGDGKACKPGVTCANFQCYPGVQCHDTVNGA
QCDSCPVGYDGDGRTCTLRNPCLDSPCPSGNIIVPTHNLQHSYQRQSQYTQRKYSVITN
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaattggtcgcgcgtgctgctaatcggcctgaccgcattggcgctgacattcgtggag
attgcatcactatcactggatccagttgcctcctccgaattggaacaatatatacgtaaa
ggtgatgttgttatatccaccagacatataagacctcgtcgcaagttacatatttccatt
gaggcactctttatgatcgattttcccatgctgaagcataaaatgtcatttttcttggat
cgcaaggagcaacgggtgacacttgatataagtgccaatggtgctacagaatcgcgtaat
ttcgaaatacccaatataaatgagacgagtactatacgatcgttggctcttcagttttcc
aagaatcgtattacattatatgtggattgtaagccaagtacacatcatgacatagaaatg
agtttaaccaaattatacacacaaatggatgatcctgtaattaaattgttccgtgagcgt
aaatatcctctgcactttgatgctgatatggaacattctttgcaaagagccaactgccag
aagggtctacatcggcggggtaacagacgcttgttgcgaaacaagatcactgaacgtgag
aagaacaagaaacgcgacgtacgcagcaattggtatgatgaacctactctgtctcgggaa
ggtgccgatcagcggcaagtggaggtgccaaccgacaatgaacgtggtgatatacccatc
atgcatggcgattgtgaagacgccctcgcacgttcgctgagcgatttaatagctttggtt
aagatgcttcgtgaagacgtcgcccaccaacgtcaggagattgcctacttgcgtttgtta
ttggagaattgtgccggctgcaaggagcctcacagcagtgaaaatcttatacgagtggat
tgtcgtacagcgaatccttgttatcctggcgtagattgtcatgattctgcaacgggtcca
aggtgtggccgttgtcctgtcggctttgttggtgacgggaaggcctgcaagccaggcgtc
acttgtgccaacttccaatgttatccaggcgttcagtgtcacgatactgtgaatggtgca
cagtgtgactcctgtccagttggctatgatggtgatggacgcacatgtacgctacgtaat
ccctgcctggattcaccatgcccctcaggtaacattatagtccccacccataacctgcaa
cactcgtatcagaggcagagccagtacacgcaacgcaaatactcggtcataacgaactaa

DBGET integrated database retrieval system