KEGG   Drosophila willistoni: Dwil_GK24300Help
Entry
Dwil_GK24300      CDS       T01067                                 

Definition
GK24300 gene product from transcript GK24300-RA
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dwi  Drosophila willistoni
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dwil_GK24300
   00052 Galactose metabolism
    Dwil_GK24300
   00500 Starch and sucrose metabolism
    Dwil_GK24300
   00520 Amino sugar and nucleotide sugar metabolism
    Dwil_GK24300
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dwil_GK24300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 513 aa AA seqDB search
MLDIPQEAKVRGHQRAPSDSKEFHEVTKRDALRLLENDVERLLKTTEPARRPALQAEMGR
FADLFGRFLQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQNEIRHMLDKLVVIKLNGG
LGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIIR
KYKGFRVQIHTFNQSCFPRVSREHFLPVAKDFDVEKDKEAWYPPGHGDFYDTFRNSGLLK
KFIEEGREYCFLSNIDNLGATVDLNILNKLVGEERASTPVEFVMEVTDKTRADVKGGTLI
QFENKLRLLEIAQVPNEHVDDFKSVKTFKFFNTNNIWANLSAIDRVLRERTLNMEIIVNN
KTLENGTRVVQLETAVGAAMKCFDGAIGVNVPRSRFLPVKKSADLLLVMSNLYTLKNGSL
VMSPQRMFPTTPLVKLGDNHFSKVKEFLGRFANIPDIIDLDHLTVSGDVTFGRGVSLRGT
VIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttggatattccccaagaagccaaggtgcgcggccatcagcgtgctccatccgactcc
aaggagttccatgaggtaaccaaacgtgatgctttgcgtctgttggagaacgatgtggaa
cgcttgctcaaaaccacagagccggcacgtcgtcccgctctgcaggcggaaatgggacgt
tttgcggatctctttggtcgcttcttgcaagaggagggacctgctctggattggaacaaa
attcaaaagttgcccgaaaacgctgtcatgaattactccaatttgaagtcgccgaaaaat
gagcagaatgagatacgtcacatgctggacaaattggttgtcatcaagttgaatggtggc
ctgggcacttctatgggctgtcatggcccaaagagtgttataccagtgcgttccgattta
accttcctggacttgacggtccagcagattgaacatctgaataagacctatgatgccaat
gtgccattggtattgatgaactctttcaataccgatgaagataccgagaaaattatacgc
aaatacaagggtttccgtgtccaaatacataccttcaatcagagttgcttcccacgtgtg
agtcgggaacattttctacctgtagccaaggactttgatgtggaaaaggataaggaggct
tggtacccgcctggtcacggcgatttctatgatacgttccgtaattcgggtctattaaag
aaattcattgaggagggtcgcgaatactgtttcctatcgaatattgataatttgggtgca
actgtcgatttgaatatattgaataaattggtgggtgaggaacgtgccagtacaccagtt
gaattcgttatggaggtcactgataaaacgcgtgctgatgttaagggtggcacacttata
caatttgagaataagctacgcctattggaaattgcgcaggtgcccaatgaacatgtggat
gatttcaagtcagtgaaaacatttaaattcttcaataccaataatatttgggccaatctc
tcagccattgatcgggtgttgcgtgagcgcactttgaacatggaaatcattgtgaacaac
aagacattggagaatggaacacgtgtcgttcagctggagactgctgtgggtgcagcgatg
aagtgtttcgatggcgccattggtgtcaatgtgccacgttcacgtttcttgcccgttaag
aaatctgccgatttgttgctcgtcatgtcgaatttatatactctcaaaaatggaagtctt
gtaatgtcaccacagcgcatgttcccaaccacacccttggtcaagctgggggataatcac
ttctccaaggtcaaggagtttttgggcagatttgccaatatacccgatataattgatctc
gatcatttgactgtcagtggcgatgtgacatttggacgcggtgtttctttgcgtggcact
gtgatcattatagccaatcatggtgatcgtattgatatacccgccggcgctatattggaa
aataaaattgtttctggcaatatgcgcatcttggatcattaa

DBGET integrated database retrieval system