KEGG   Drosophila willistoni: Dwil_GK24306Help
Entry
Dwil_GK24306      CDS       T01067                                 

Definition
GK24306 gene product from transcript GK24306-RA
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dwil_GK24306
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dwil_GK24306
   00020 Citrate cycle (TCA cycle)
    Dwil_GK24306
   00620 Pyruvate metabolism
    Dwil_GK24306
Enzymes [BR:dwi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dwil_GK24306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 507 aa AA seqDB search
MLRSIATKGSELGALRSLILLRTARRSPGTGVRALSTQLINSRNLQAIRTLTAKLESRTK
PVGVWSYNFARNYASLPEHIRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETDK
ATMGFETPEEGYLAKILIAGGTKDVPVGQLVCIIVPDQGSIAAFKDFKDDGAGAAPPAAA
AAPPPPPAAAAAPAPVAAAAPAPPPPAPAAGQTASEQRGDRVYASPMAKKLAEAQKLRLQ
GKGSGVHGSIKSGDLAEASARAAASGGAAASRAPGARYTDIPVTNMRAIIAKRLLESKTQ
LPHYYVTVQCQVDNLLKLRARINKKYEKKGVRVSVNDFIIKATAIASLKVPEANSSWMDS
VIRQYDDVDVSVAVSTDKGLITPIIFNADRKGVIDISKDVKELAEKARQNKLQPHEFQGG
TISVSNLGMFGVNQFCAVINPPQSCILAIGTTTKQLVLDPDNIKGFKEINLLTVTLSADH
RVVDGAVAARWLQHFRDFIEDPANMIL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgttctattgcaacaaaaggaagcgaactaggagctctgcgttcccttatcctg
ctacgtacggcccgccgatcgcctggaactggagtgcgcgcccttagcacacagctgatc
aattcacggaatctccaggccatcaggacactgactgcaaaattggaaagtagaaccaaa
cccgttggtgtctggagctataactttgcccgtaactatgccagtctaccggaacacatc
cgagtgccattgcccgcactgtcccctaccatggagcggggctccatcgttagctgggag
aagaaagagggcgataaactgaatgagggtgatttgctgtgcgaaatcgaaactgataaa
gccaccatgggtttcgagacacccgaggagggttatttggccaagatattgattgccggc
ggtaccaaagatgttcctgtgggacaattggtgtgcattatagtgcccgatcagggtagc
atagcggcctttaaggatttcaaagatgatggagcaggagcagctccccccgcagcagca
gcagccccaccaccaccaccggcagcagcagcagcaccggcacctgtagcagcagctgct
ccagctcctccaccaccagcaccagcagcaggtcagaccgcctcagagcaacggggcgat
cgtgtttatgccagtcccatggccaaaaaattagccgaagcacaaaagctgcgtctacaa
ggcaaaggtagcggcgtccatggctcaattaaatctggtgatcttgcagaagcatccgca
agggccgcagcatctggtggcgccgccgcatccagggctccaggtgctcgctacacggat
attccagtgaccaatatgcgtgccattatagccaagcgtctgctcgaatcgaagactcaa
ctcccacactattacgtgaccgttcagtgtcaagtcgataatctcctcaagttgcgcgcc
aggatcaataagaagtacgagaagaagggtgttcgcgtttcggtcaacgattttatcatc
aaggccactgccattgccagtcttaaggtgccagaggccaattcgtcgtggatggattcg
gttattcgtcaatatgatgatgtcgatgtctctgtggctgtttccaccgacaagggacta
atcactcccattatcttcaatgccgatcgtaagggtgtcatcgatatctccaaggatgta
aaagaactggccgaaaaggctcgccagaataaactgcagccccatgagttccaaggtggc
accatttcggtatcgaatctgggcatgttcggtgtcaatcaattctgtgccgtcatcaat
cctccgcaatcttgcatcttggccattggcaccacaacgaaacagttggtactggatcca
gataatattaagggtttcaaggaaatcaacctgcttactgtcactctgagtgccgatcat
cgggttgttgatggcgctgtggctgccagatggttgcaacatttccgtgactttattgaa
gatccagccaatatgattttgtag

DBGET integrated database retrieval system