KEGG   Drosophila willistoni: Dwil_GK24306Help
Entry
Dwil_GK24306      CDS       T01067                                 

Definition
GK24306 gene product from transcript GK24306-RA
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:dwi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dwi00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dwi00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dwi00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 507 aa AA seqDB search
MLRSIATKGSELGALRSLILLRTARRSPGTGVRALSTQLINSRNLQAIRTLTAKLESRTK
PVGVWSYNFARNYASLPEHIRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETDK
ATMGFETPEEGYLAKILIAGGTKDVPVGQLVCIIVPDQGSIAAFKDFKDDGAGAAPPAAA
AAPPPPPAAAAAPAPVAAAAPAPPPPAPAAGQTASEQRGDRVYASPMAKKLAEAQKLRLQ
GKGSGVHGSIKSGDLAEASARAAASGGAAASRAPGARYTDIPVTNMRAIIAKRLLESKTQ
LPHYYVTVQCQVDNLLKLRARINKKYEKKGVRVSVNDFIIKATAIASLKVPEANSSWMDS
VIRQYDDVDVSVAVSTDKGLITPIIFNADRKGVIDISKDVKELAEKARQNKLQPHEFQGG
TISVSNLGMFGVNQFCAVINPPQSCILAIGTTTKQLVLDPDNIKGFKEINLLTVTLSADH
RVVDGAVAARWLQHFRDFIEDPANMIL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgttctattgcaacaaaaggaagcgaactaggagctctgcgttcccttatcctg
ctacgtacggcccgccgatcgcctggaactggagtgcgcgcccttagcacacagctgatc
aattcacggaatctccaggccatcaggacactgactgcaaaattggaaagtagaaccaaa
cccgttggtgtctggagctataactttgcccgtaactatgccagtctaccggaacacatc
cgagtgccattgcccgcactgtcccctaccatggagcggggctccatcgttagctgggag
aagaaagagggcgataaactgaatgagggtgatttgctgtgcgaaatcgaaactgataaa
gccaccatgggtttcgagacacccgaggagggttatttggccaagatattgattgccggc
ggtaccaaagatgttcctgtgggacaattggtgtgcattatagtgcccgatcagggtagc
atagcggcctttaaggatttcaaagatgatggagcaggagcagctccccccgcagcagca
gcagccccaccaccaccaccggcagcagcagcagcaccggcacctgtagcagcagctgct
ccagctcctccaccaccagcaccagcagcaggtcagaccgcctcagagcaacggggcgat
cgtgtttatgccagtcccatggccaaaaaattagccgaagcacaaaagctgcgtctacaa
ggcaaaggtagcggcgtccatggctcaattaaatctggtgatcttgcagaagcatccgca
agggccgcagcatctggtggcgccgccgcatccagggctccaggtgctcgctacacggat
attccagtgaccaatatgcgtgccattatagccaagcgtctgctcgaatcgaagactcaa
ctcccacactattacgtgaccgttcagtgtcaagtcgataatctcctcaagttgcgcgcc
aggatcaataagaagtacgagaagaagggtgttcgcgtttcggtcaacgattttatcatc
aaggccactgccattgccagtcttaaggtgccagaggccaattcgtcgtggatggattcg
gttattcgtcaatatgatgatgtcgatgtctctgtggctgtttccaccgacaagggacta
atcactcccattatcttcaatgccgatcgtaagggtgtcatcgatatctccaaggatgta
aaagaactggccgaaaaggctcgccagaataaactgcagccccatgagttccaaggtggc
accatttcggtatcgaatctgggcatgttcggtgtcaatcaattctgtgccgtcatcaat
cctccgcaatcttgcatcttggccattggcaccacaacgaaacagttggtactggatcca
gataatattaagggtttcaaggaaatcaacctgcttactgtcactctgagtgccgatcat
cgggttgttgatggcgctgtggctgccagatggttgcaacatttccgtgactttattgaa
gatccagccaatatgattttgtag

DBGET integrated database retrieval system