KEGG   Drosophila willistoni: Dwil_GK24313Help
Entry
Dwil_GK24313      CDS       T01067                                 

Definition
GK24313 gene product from transcript GK24313-RA
Orthology
K10739  
replication factor A2
Organism
dwi  Drosophila willistoni
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dwil_GK24313
   03420 Nucleotide excision repair
    Dwil_GK24313
   03430 Mismatch repair
    Dwil_GK24313
   03440 Homologous recombination
    Dwil_GK24313
   03460 Fanconi anemia pathway
    Dwil_GK24313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 239 aa AA seqDB search
MNDSFGDFNATQTAGAASEQKGEGILPMLIKQILLLPEGNIELFGMHYAMTTVVAIVRNI
ETSSTKITYTLEDHTGRLDAHYWLEEGDAHKAPDVMLNNYVRVYGTTRSQGGQKTLMVFK
ALPVLDPNEVTTHLLEVLNARYKAEAYQEKGGSSGHQNSTMPDFSASQSNALVNGLDAKQ
QAVFQAIKSNVSEEGIGRKELKGKFSHISDSELNNILEFMISEGHIYSSIDADHFICTM
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaacgattcctttggagatttcaatgccacccagacagctggcgctgcatcggagcag
aagggagagggaatcctccccatgctaataaagcagattctccttctgcccgagggcaat
atcgagctatttggcatgcactatgccatgaccacagtggttgcaattgtgcgcaatatt
gagacatcctcgaccaagataacctacacgctggaggatcacactggacgtcttgatgcc
cattattggctggaggaaggtgatgctcataaagctcccgatgtcatgctgaataactat
gttcgcgtctatggcacaacacgatcccaggggggccaaaagacactaatggtgttcaaa
gcattgcccgtgctagatcccaatgaggttaccacacatcttcttgaggtgctaaatgcc
cgctacaaggcagaggcctatcaagagaagggtggttcgtcaggtcatcagaattccaca
atgcccgatttcagtgccagccaaagtaatgccctggtcaacggtttggatgccaagcaa
caggccgtattccaggccattaagagtaacgtctccgaggagggcattggtcgtaaggag
ttaaagggcaaattctctcacatcagcgattcggaattgaacaacattctggaattcatg
atctcggaaggccatatttattcaagcatagatgctgatcacttcatctgtaccatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system