KEGG   Drosophila willistoni: Dwil_GK24313Help
Entry
Dwil_GK24313      CDS       T01067                                 

Definition
(RefSeq) GK24313 gene product from transcript GK24313-RA
  KO
K10739  
replication factor A2
Organism
dwi  Drosophila willistoni
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dwil_GK24313
   03420 Nucleotide excision repair
    Dwil_GK24313
   03430 Mismatch repair
    Dwil_GK24313
   03440 Homologous recombination
    Dwil_GK24313
   03460 Fanconi anemia pathway
    Dwil_GK24313
DNA replication proteins [BR:dwi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dwil_GK24313
DNA repair and recombination proteins [BR:dwi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dwil_GK24313
   MMR (mismatch exicision repair)
     Dwil_GK24313
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dwil_GK24313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 239 aa AA seqDB search
MNDSFGDFNATQTAGAASEQKGEGILPMLIKQILLLPEGNIELFGMHYAMTTVVAIVRNI
ETSSTKITYTLEDHTGRLDAHYWLEEGDAHKAPDVMLNNYVRVYGTTRSQGGQKTLMVFK
ALPVLDPNEVTTHLLEVLNARYKAEAYQEKGGSSGHQNSTMPDFSASQSNALVNGLDAKQ
QAVFQAIKSNVSEEGIGRKELKGKFSHISDSELNNILEFMISEGHIYSSIDADHFICTM
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaacgattcctttggagatttcaatgccacccagacagctggcgctgcatcggagcag
aagggagagggaatcctccccatgctaataaagcagattctccttctgcccgagggcaat
atcgagctatttggcatgcactatgccatgaccacagtggttgcaattgtgcgcaatatt
gagacatcctcgaccaagataacctacacgctggaggatcacactggacgtcttgatgcc
cattattggctggaggaaggtgatgctcataaagctcccgatgtcatgctgaataactat
gttcgcgtctatggcacaacacgatcccaggggggccaaaagacactaatggtgttcaaa
gcattgcccgtgctagatcccaatgaggttaccacacatcttcttgaggtgctaaatgcc
cgctacaaggcagaggcctatcaagagaagggtggttcgtcaggtcatcagaattccaca
atgcccgatttcagtgccagccaaagtaatgccctggtcaacggtttggatgccaagcaa
caggccgtattccaggccattaagagtaacgtctccgaggagggcattggtcgtaaggag
ttaaagggcaaattctctcacatcagcgattcggaattgaacaacattctggaattcatg
atctcggaaggccatatttattcaagcatagatgctgatcacttcatctgtaccatgtaa

DBGET integrated database retrieval system