KEGG   Drosophila willistoni: Dwil_GK24326Help
Entry
Dwil_GK24326      CDS       T01067                                 

Definition
GK24326 gene product from transcript GK24326-RA
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dwi  Drosophila willistoni
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dwil_GK24326
Enzymes [BR:dwi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dwil_GK24326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 436 aa AA seqDB search
MKQLSSLLLLAFIAGAAQAAFYSPSDGVVELTPSNFDKLVTNDDSVWIVEFFAPWCGHCQ
SLVPEYIKLAKALKGVVKVGSVNADEHNSLGGQFNVRGFPTIKIFGANKRSPTDFNGQRT
AKAIAEAALAEVKKKVQAALGGGGSSSNGGSSSSDDDVIELTEDNFDKLVLNSDDIWLVE
FFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFAANSK
RASDAQEYDGGRTASDIISWASDKHVANVPAPELIEIINESTFDTACEGKPLCVVSVLPH
ILDCDAKCRNKFLDTLRTLGEKYKQKQWGWGWTEGAQQLALEESLEVGGFGYPAMAVVNF
KKMKFSVLKGSFSKDGINEFLRDISFGRGHTAPVRGAKKPAIVSVDPWDGKDGELPAEED
IDLSDIDLDDNGKDEL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgtcaagcctattgttgttggcatttattgcgggggctgctcaagccgcc
ttctattccccctccgatggcgttgtggaattgacgccctcaaattttgataaactagtg
accaacgatgattctgtatggattgtggaattctttgcaccctggtgtggtcattgtcag
agcttggttcctgaatatatcaaactggccaaggcattgaaaggtgttgtcaaggtgggc
tctgttaatgcagatgaacataattcgcttggtggccaattcaatgtacgtggctttccc
acaatcaaaatattcggagccaataaacgatcgcccacggatttcaatggccaacgcaca
gctaaagctattgccgaagctgctctagctgaggtgaagaagaaggtgcaagcagcttta
ggcggcggcggcagcagcagcaatggtggcagctcatccagtgatgatgatgtcattgaa
ctgactgaagataactttgacaaactggtattgaactcagatgacatttggctggtcgaa
ttctttgcaccatggtgcggacactgcaagaatttggctcccgaatgggctaaggctgcc
aaggagctgaagggcaaggttaagctaggtgctctcgatgccacagcccatcaaagcaag
gccgccgagtataatgtgcgtggatatccaacaattaagttctttgccgccaattccaaa
cgggccagcgatgctcaagaatacgatggtggtcgcactgcctctgatattatatcctgg
gctagtgataagcacgtagccaatgtcccagccccagagctaatcgagatcattaatgaa
tccacattcgatacagcctgcgagggcaaaccattgtgtgtagtttctgtattgccgcat
atcctcgactgtgatgccaagtgccgcaacaaattcctggacactttgcgtactctgggc
gagaagtataagcagaaacaatggggctggggctggactgagggtgctcaacagctggct
cttgaggaatcattggaagtgggaggattcggttatcctgccatggctgtggttaacttt
aagaaaatgaaattctctgtcctcaagggctccttttccaaggatggcatcaatgagttc
ctacgcgacatctcctttggacgtggtcatacagccccagtacgtggagccaagaagccc
gccattgtcagtgtcgatccctgggatggcaaggatggtgaattgcccgccgaggaagat
attgatttgagcgacatcgatctagatgataatggcaaggatgaactgtaa

DBGET integrated database retrieval system