KEGG   Drosophila willistoni: Dwil_GK24390Help
Entry
Dwil_GK24390      CDS       T01067                                 

Definition
GK24390 gene product from transcript GK24390-RA
Orthology
K03099  
son of sevenless
Organism
dwi  Drosophila willistoni
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dwil_GK24390
   04630 Jak-STAT signaling pathway
    Dwil_GK24390
   04068 FoxO signaling pathway
    Dwil_GK24390
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dwil_GK24390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1586 aa AA seqDB search
MFSGSSGGHSHVISCADALQDCDGYDFTKNENAARWRGLFIPSLRKVLEQVHPRVTAKED
ALMYVEKLCLRILAILCAKPLPHSVQDVEEKVNKSFPSPIDQWALKEAHEVINSKKRKSV
LPTERVHSLLQKDVLQYKIDSSVSAFLVAVLEYISADILKMAGDYVCKISHCEITKEDIE
VVMNADRVLMDMFNQSSDLKQNVLPSPLSLPPQRASATYEETVKELIHDEKQYQRDLHMI
IRVFREELVKIVRDPKELEPIFSNIMDIYEVTVTLLGSLEDVIEMSQEQNAPCVGSCFEE
LAEAEEFDVYKKYAHDVTSQASRDALSQLLAKPDALSLISAGHGFRDAVKYYLPKLLLVP
ICHAFVYFDYIKHLMDLSSSQDDIESFVQVQGLLHPLHCDLEKVMAGLSKDRMVPVSGRV
RRQLAIERTRELQLKVEHWDDKDVGQNCNEFIRDDSLSKLGSGKRIWSERKVFLFDGLMV
LCKANTKKQTPSAGCTAYDYRLKEKFFMRRVEINDRVDTDELKNSFELVTRMQPAIVLTA
KNAQHKNDWMADLIMVNTKSMLDRILDSILQDIERKHPLRMPNPEIYKFAIPDSSENIVL
EERESAGVPMIKGATLCKLIERLTYHIYADPTFVRTFLTTYRYFCSPPQLLQLLIERFNI
PDPSLVYQDCGAGGAGGAGGLAGGGDKEHKNSQREDWKRYRKEFVQPVQFRVLNVLRHWV
DHHFYDFEKDPTLLDKLLHFLEHVNGKSMRKWVDSVLKIVQRKNEQEKSNKKIVYAYGHD
PPPIENHLSVPNEEINLLTLHPLELARQLTLLEFEMYKNVKPSELVGSPWTKKDKELKSP
NLLKIMKHTTNVTRWIEKSITEAENYEERVAIMQRAIEVMMVMLELNNFNGILSIVAALG
TASVYRLRWTFQGLPERYRKFLDECRELSDDHLKKYQERLRSINPPCVPFFGRYLTNILH
LEEGNPDLLANTELINFSKRRKVAEIIGEIQQYQNQPYCLNEEPIIRQFLEQLDPFSGLS
DKEMCDNPYKESLRIEPRGCKTWPKFPRKWPHIPLKSPGIKPRRQNQNNSNSKTQPQTAA
AAAAATSAAAVVVPSTTNHNPPPSSIEPPQGAANVLGDQSPQHNPHAFSVFAPVIIPERN
GTSWSGTPLHHPANRSDTNNGEVAAPAPHLPRKPAAHVWTNNAMAMTANPTDTFSPSLLE
QQQQQQHQLPDTTHNPFAMAMTDADAPPSPLPKLVVSPNRSPFHARTQYSPTHSIASTVT
LTGAATSLAGTEGGDLSPQLGGFYYNSAHQTGQVGAVPISPHVNVPSVSNIEYRAVPPPL
PPRRKERTDSCADMAQKRQAPDAPTLPPRDGELSPPPIPPRLNHSTGTIGSHGRHSHGQA
KEFAGKNSLLLPNTSSIMIRRNSAIEKRAAAAAQQQQMGVSSSLGCNQTTTFVTVSQPQA
TTGSEEQQHPPQSISPALSSSTTTSPMTPMTPMSPHIPSNPVESTHQLRLKPQQPHQQSH
SIPTHHHQHSHHQQHHHPHPHPLPHAHPQTHNASQSQNRSSPKEFYSISTSHEGTPKLPP
KPSLSANFYNNPDKGTMFLYPSTNQE
NT seq 4761 nt NT seq  +upstreamnt  +downstreamnt
atgttttccggcagcagcggaggccatagtcatgtcattagctgtgcagatgctctgcag
gattgcgatggctatgacttcacgaaaaatgaaaatgcagctcgctggcgtggtctattc
ataccatcgctgcgcaaggtgctggagcaagtgcatccgcgggtaacagccaaagaggat
gctctaatgtatgtggagaagttgtgtttgcgcattctggccattttatgtgccaagccg
ctgccccactccgtgcaggatgtggaagagaaggttaacaaatcgtttccatcccccatc
gatcaatgggcgctcaaggaagcacacgaagtgattaattcaaaaaagcgtaaaagtgtc
ctacccacagagcgtgttcactcgctgctccagaaggatgtgctccaatataagattgat
agttccgtctcagctttcctggtggccgttctcgagtacatttcggcggatatattgaaa
atggccggggattatgtttgcaaaatctcgcattgcgagatcaccaaggaggacattgag
gtggtaatgaatgccgatcgagtgctcatggatatgttcaatcagagctctgacctgaag
caaaacgtcctgcccagtcccctctcgctgcctccgcagagggctagcgccacatacgaa
gagactgtgaaagaactcatccacgatgagaagcaatatcagcgcgatcttcacatgatt
attcgagtttttcgcgaggaactggtcaagatagtgcgcgacccgaaggagctcgaaccc
attttcagtaacatcatggacatctatgaggtgacagtgacgcttctgggctcactcgag
gacgtcatagagatgtcgcaagaacaaaatgctccctgtgtgggcagttgctttgaggaa
cttgccgaagcggaggaattcgatgtatataagaagtatgcccatgatgtgacctcgcag
gcctcccgtgatgccctcagccaattgttggccaagccagacgctttatccctgatctct
gctggccatggctttcgcgatgccgttaagtattatttaccaaagctccttttggtcccc
atatgccatgcctttgtttacttcgattatatcaagcatttgatggatctcagttcgtcg
caggatgatattgaaagttttgtgcaggttcagggtctgctgcatcctttgcattgcgat
cttgaaaaggtaatggctggtctgtccaaggaccgtatggttccagtcagtggacgcgtg
cgacgtcaattggcgattgagagaactcgggagctgcaactcaaggtggagcactgggac
gacaaagatgtgggtcagaattgcaatgaatttatacgcgatgattctctaagtaaactc
ggttcaggcaaacgcatttggagcgaacgcaaagtgtttctcttcgatgggttaatggtc
ctgtgcaaggccaatacaaagaagcaaaccccctcggccggatgcaccgcctacgattat
cggctgaaggagaagttcttcatgcgacgggtcgagatcaatgacagagtcgacacagat
gagttaaaaaatagtttcgagctggtgacccgaatgcagcctgctattgttttgactgcc
aagaatgcacagcataagaacgattggatggccgatctaataatggtcaatacaaaatcc
atgctagatcgaatattggacagcatattgcaggatattgaacgcaaacatccgttgcgc
atgcccaatccagagatctacaaatttgccatacccgacagcagcgaaaacattgtgctg
gaggagcgcgagagcgccggagtgcccatgatcaagggggcaacgctgtgcaagctaatc
gaacgcctaacctatcacatttatgcggatccgacatttgtgcgtacgtttctcaccaca
tatcgatatttttgttcacccccccaactgcttcaactgctaatcgaacggttcaatata
cccgatccgagtctggtctatcaggattgcggagctggcggggctggtggagctggagga
ttggctggcggtggtgataaggagcacaagaactctcagcgtgaggattggaagcgttac
cgcaaggagtttgtgcagccggtgcagttccgcgtcctcaatgtccttcgccattgggtg
gatcatcatttctatgattttgagaaggatcccacattactcgacaaattgctgcatttt
ttggagcacgtaaatggcaaatccatgcgcaagtgggtcgattctgtactcaaaattgtt
cagcgtaaaaatgaacaggaaaaaagcaataaaaagattgtctatgcctatggccatgat
ccgccacccattgaaaaccacctgagtgtgcctaacgaggagatcaacctactcacctta
catcctctagagctggcacgtcagctaacgctgctggaattcgaaatgtacaagaatgtg
aagccatcggagttggtcggctccccatggacgaagaaggacaaagaactaaagagtccc
aatttgctcaaaatcatgaagcacaccaccaatgtgacccggtggatcgaaaaatcgata
acagaggccgaaaactatgaggagcgtgtggccattatgcagcgtgcgattgaagtgatg
atggttatgctggaactgaacaacttcaatggcattctctcgattgtggccgctttgggt
acggcatcggtgtatcgcttgcgctggacatttcaaggactgcccgagcgctaccgcaag
ttcctcgacgagtgccgtgaactgagcgatgatcatctcaagaaatatcaagagcggctg
cgatccattaatccgccctgtgtgccattctttggtcggtatttgaccaatattcttcat
ttggaagagggtaatccggatttgctggcaaacacggaactaatcaatttctcgaaacgt
cgaaaagtcgccgaaattatcggtgaaattcaacagtatcaaaatcagccatattgtctt
aacgaggagccaattatacggcaatttttggagcaacttgatccatttagcggactctca
gacaaggaaatgtgcgacaatccatacaaagagagtttgcgcattgaaccgcgtggttgc
aagacatggcctaaatttccccgtaaatggccgcacattccactcaaatcgcctggcatc
aagccgcgtcgtcagaaccagaacaacagcaacagcaaaactcagccccaaacagctgcc
gcagcagcagcagcaacatctgcagctgcggtcgtcgtgccatctaccacaaaccacaat
cctcctccatccagcatagaaccaccacaaggggcggccaacgtgttgggcgatcaaagt
ccccagcataatcctcatgctttctctgtattcgcgccagtcattataccggaacgcaat
ggtaccagctggagtggcacacctttgcatcatccggccaatcgttcggacactaacaac
ggagaggtggcggcgccagccccccatttacctcgaaaaccggcagctcatgtatggacc
aacaatgcaatggcaatgactgcaaatcctacggatacgtttagcccaagtctgctggaa
cagcagcagcagcaacagcatcaactaccagataccacacacaatccattcgctatggca
atgaccgatgcagatgctcccccctcaccgttaccaaaactagtagttagtccgaatcgg
tcaccattccatgcgcgaactcaatacagtcccacgcatagcatagccagtacggtgact
ctcacgggagcagcgactagtttagcaggaacagaaggaggagatttgagtcctcagctt
ggtggcttctactataacagcgcccatcagaccggacaagtgggggcagtgcccatttct
ccgcatgtaaatgttccaagcgtttcgaatatcgagtatcgggcagtgccgcctccactg
ccaccgcgacgtaaagagcgcaccgacagctgcgcagatatggcccagaagcgccaggcc
ccagatgccccaacgttacccccacgcgatggcgaactaagtccgccgcctataccgccg
agactcaatcattccacgggcaccataggcagccatggtcggcatagtcatggccaggca
aaggagtttgcgggcaagaacagtttgcttctgcccaatactagcagtattatgatacgt
cggaattcggccatagaaaagcgagcagcagcagctgcgcaacagcaacagatgggagtg
tccagctctttgggctgcaatcagaccaccacttttgtcactgtgtcacagccgcaggca
acaacagggtctgaggagcagcagcatccgccgcaatcgatctcaccggcgttaagctcg
tcgacaactacatcacccatgacccccatgactcccatgtccccgcacattcccagcaat
cctgtcgagagcactcatcagcttcgcttgaagccgcaacaaccccaccagcaatctcat
tcgatacctacccatcatcaccagcattctcatcatcagcaacatcatcatccgcacccg
catccactcccacatgcccatccacagacccacaatgccagccaatcacaaaaccgctcg
tccccaaaggaattctactccatttctacgagtcacgagggcacccccaaacttccacca
aaacctagtctaagcgcaaacttctataacaatccagataaaggtacgatgtttctttac
ccaagtacaaaccaagaataa

DBGET integrated database retrieval system