KEGG   Drosophila willistoni: Dwil_GK24407Help
Entry
Dwil_GK24407      CDS       T01067                                 

Definition
GK24407 gene product from transcript GK24407-RA
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dwi  Drosophila willistoni
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dwil_GK24407
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Dwil_GK24407
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Dwil_GK24407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 352 aa AA seqDB search
MFATPLRQPQASGSTDKLQNHQQDTPYQYEITDHGYGKDAVKVLHVSRKGPVHTIHEFEV
GTHLKLYSKKDYYQGNNSDVVATDSQKNTVYLLAKKHGIESPEMFALLLAKHFLNKYSHV
EEAHVHVEAYPWQRVCQEETKTMWNGKGACNGDPKLGNCNFSSIDDRQLHNHAFIFTPTA
QHYSDVVMRRNDPKQTVISGIKGLRVLKTTQSSFVNFVNDEFRSLPDQYDRIFSTVVDCS
WEYSDTESVNFSRAWQTVKNIILKNFAGDPNIGVSSPSVQHTLYLSEKEVLDVLPQVSVI
SMTMPNKHYFNFDTKHFQKIVPGDNNEVFIPVDKPHGTIYAQLARKDLKSKL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccacacctcttagacagccacaagcaagtggaagtacagacaagctccagaat
catcaacaggatacaccctaccagtacgagatcacagatcatggctatggaaaagatgca
gttaaggttctacatgtcagtcggaaaggaccagtgcacacgattcacgaattcgaggtg
ggcacacatctgaaattgtacagcaaaaaggactactaccagggcaacaactccgatgtg
gtggccaccgattcgcagaagaacactgtctacttgctggccaagaagcatggcattgag
agtccagaaatgtttgccctgcttttggccaaacatttcctcaacaagtactcgcatgtg
gaggaggctcatgtgcacgtggaagcctatccctggcaacgtgtgtgccaggaggagacc
aagaccatgtggaatggaaagggtgcatgcaacggcgatcccaagctgggtaactgcaac
ttcagttccatcgatgaccgccaactacacaaccatgcgttcattttcaccccaacggct
cagcactacagtgatgtggtcatgcgaaggaatgatcccaaacaaaccgtcatcagtggg
atcaaaggcctccgtgtactgaagaccacccagtcgtcgtttgttaactttgtcaacgac
gagtttcgttcgcttcccgatcaatatgatcgcatcttcagcaccgtggtggactgctcc
tgggagtactccgataccgagtcggtaaacttttcgcgggcttggcaaacagttaagaac
atcatcttgaagaactttgccggcgatcccaacattggtgtctcctccccttcggtccaa
cacactttgtatctcagcgaaaaggaagtgctggatgtcttgccccaagtttccgtcata
tcgatgacaatgccgaataagcattactttaactttgatacaaaacactttcagaaaatc
gttccaggcgacaataatgaggtgttcatacctgtggataagccacatggtaccatctat
gcacaattggctcgaaaggatctcaaaagtaaactctaa

DBGET integrated database retrieval system