KEGG   Drosophila willistoni: Dwil_GK24624Help
Entry
Dwil_GK24624      CDS       T01067                                 

Definition
GK24624 gene product from transcript GK24624-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dwi  Drosophila willistoni
Module
cGMP signaling
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dwil_GK24624
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dwil_GK24624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 779 aa AA seqDB search
MNDRERDGLISSLHNDVLALKDLVRNRENELVKLHREIHKLKSVLQQTTNHLNVTRNEQK
QQHQQPQQQSPQRGRLYSLPEQCGDVTTSSQINPHICSSCGMVMPTSPEFALEALSLGGS
APSPSPSPSPTSNSVSAPQLPEVRPKATTKKQGVSAESCVQSIHQSYNVPIPKYDKDFSA
KQQIKDAIMDNDFLKNIDASQVRELVDSMYSKCIAAGEFVVREGEAGAHLYVSAAGEFAV
MQNGKVLDKMGPGKAFGELAILYNCTRTASIRVLTTSEDARVWVLDRRVFQQIMMRTGLQ
RIENSVNFLKSVPLLRNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVR
VTQKLTATSLEETELRILSRGDYFGEQALINEDRRTANIIALPPGVECLTLDRDSFKRLI
GDLCELKEKDYGDESRILAMKQAAENQEIFGSQAQQQQEYPDLKLTDLEVVSTLGIGGFG
RVELVKAYHNDRVDTFALKCLKKRHIVDTKQEEHIFSERTIMLSSKSPFICRLYRTFRDD
KYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHSHGIIYRDLKPENLM
LDERGYVKLVDFGFAKYIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHEL
LNGTPPFSAPDPMQTYNLILKGIDMISFPKQMSRWAVQLIKRLCRDVPSERLGYQTGGIQ
DIKKHKWFLGFDWDGLASQLLIPPFVRPIAHSTDVRYFDRFPCDPTEPPDELSGWDAEF
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcgtgaacgggatggtttgatcagcagcttgcacaatgatgtgcttgccctg
aaggatctggtgagaaatcgtgaaaacgagctggtcaaattacatagggaaatccacaag
ttaaagagcgtacttcagcagaccaccaatcacttgaacgtgacacgaaatgagcaaaag
caacaacaccaacagccacaacaacagagtccacaacggggtcggctgtattccctgccc
gagcaatgcggtgacgtgacaacaagcagccaaataaatccgcacatttgcagctcttgc
ggaatggttatgcccacaagcccagagtttgcacttgaggctttatcattggggggatcg
gctccaagcccatctccatctccgtcgccaacttccaactcagtatcggccccacaactg
ccagaagtacgcccgaaagctaccaccaagaaacagggcgtatctgccgagagttgtgta
cagtcaattcatcagtcctacaatgttcccatacccaaatatgataaagatttcagtgcc
aagcaacagatcaaagatgctattatggataatgattttctcaagaatatcgacgcctct
caagtacgtgaacttgtcgattccatgtattccaagtgcattgccgctggagaattcgtg
gtacgtgagggtgaagctggtgcccatttgtatgtatccgcagcgggagaattcgctgtc
atgcaaaatggcaaagtgctggataaaatgggtcccggcaaggcctttggggaattggcc
atactttacaattgcactcgaaccgcttcaattcgtgtgctaacaactagcgaagatgcc
cgcgtttgggtcctggatcgtcgggtctttcaacagattatgatgcgtacgggtctgcag
cgaattgagaatagtgtgaacttcctaaagtcagtgccactactacgcaatctcagcgaa
gagttgttggccaaaattgctgatgttctggaactggagttctatgcggctggcacgtat
atcattagacaaggcactgccggcgatagcttctttctcatatcgcagggtaatgtcagg
gtaacccaaaaactgacagccacctcactagaggagacagagttgcggatattgtcgcgg
ggtgattactttggcgaacaggctctaatcaatgaggaccggaggacagcgaatattata
gcattaccaccaggtgttgagtgccttactttggatcgagattcatttaaacggctaatt
ggagatttgtgtgagttgaaggagaaggactatggcgatgaaagccgcattttagccatg
aaacaagccgccgagaatcaggagattttcggctctcaagcccagcagcagcaggaatat
ccggatctaaaattaacagacctggaagtggttagcactcttggtatcggtggctttggg
cgagtagaactggtcaaggcctatcacaatgatcgtgtggatacatttgctctcaagtgc
ctgaaaaaacgtcacattgtggacacgaagcaggaggagcatatatttagtgaacgcacc
attatgttaagttctaagtcaccgttcatttgtcgcctctatcggacttttcgggacgat
aaatacgtctatatgctcctagaggcctgtatgggtggcgaaatatggaccatgctgcga
gatcgcggctcctttgaggataatgcggcacaattcattattggctgtgtcctgcaggcc
tttgagtatctgcattcccatggcattatctatcgtgatctcaaacccgaaaacctaatg
ctagatgagcgaggctatgtgaaactggttgactttggtttcgccaagtatataggtaca
agctccaaaacttggacgttttgtggtactcccgagtacgtggcacccgagatcatcttg
aataaaggtcacgatcgagctgtggactactgggctctgggcatacttattcatgagtta
ctcaacggaactcctccgttcagtgctccagatcctatgcaaacctataatctcattctt
aagggcattgatatgataagttttcccaaacaaatgtcacgatgggcagtacaattgatt
aagcgattgtgtcgtgacgtcccctctgaacgcttgggctatcagacgggtggaattcag
gacatcaaaaagcacaaatggtttcttggtttcgattgggatggcttagccagtcaactc
ttaattccgccttttgttcgcccaattgctcactcgacagatgtgcgttactttgatcga
tttccctgtgatccaaccgaaccacccgatgaactttctggctgggatgctgaattctag

DBGET integrated database retrieval system