KEGG   Drosophila willistoni: Dwil_GK24639Help
Entry
Dwil_GK24639      CDS       T01067                                 

Definition
GK24639 gene product from transcript GK24639-RA
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dwi  Drosophila willistoni
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dwi00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:dwi00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 346 aa AA seqDB search
MFVKPLQKASSLSLSQNPTHSQYEITDHGYGKDAVKVLHVSRKGPVHTIHEFEVGTHLKL
YSKKDYYQGNNSDVVATDSQKNTVYLLAKKHGIESPEMFALLLAKHFLNKYSHVEEAHVH
VEAYPWQRVCQEETKTMWNGKGACNGDPKLGNCNFSSIDDRQLHNHAFIFTPTAQHYSDV
VMRRNDPKQTVISGIKGLRVLKTTQSSFVNFVNDEFRSLPDQYDRIFSTVVDCSWEYSDT
ESVNFSRAWQTVNNIILKNFAGDPNIGVSSPSVQHTLYLSEKEVLDVLPQVSVISMTMPN
KHYFNFDTKHFQKIVPGDNNEVFIPVDKPHGTIYAQLARKDLRSRL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcaagccattgcaaaaagcatcaagcctctctcttagccagaacccaactcat
tcgcagtacgagatcacagatcatggctatggaaaagatgcagttaaggttcttcatgtc
agtcggaaaggaccagtgcacacgattcacgaattcgaggtgggcacacatctgaaattg
tacagcaaaaaggactactaccagggcaacaactccgatgtggtggccaccgattcgcag
aagaacactgtctacttgctggccaagaagcacggcatcgagagtccagaaatgtttgcc
ctacttttggccaaacatttcctcaacaagtactcgcatgtggaggaggcccatgtgcac
gtggaagcctatccctggcaacgtgtgtgccaggaggagaccaagaccatgtggaatgga
aagggtgcatgcaacggcgatcccaagctgggtaactgcaacttcagttccatcgatgac
cgccaactacacaaccatgcgttcattttcaccccaacggctcagcactacagtgatgtg
gtcatgcgaaggaatgatcccaaacaaaccgtcatcagtgggatcaaaggcctccgtgta
ctgaagaccacccagtcgtcgtttgttaactttgtcaacgacgagtttcgttcgcttccc
gatcaatatgatcgcatcttcagcaccgtggtggactgctcctgggagtactccgatacc
gagtcggtaaacttttcgcgggcttggcaaacagttaacaacatcatcttgaagaacttt
gccggtgatcccaacattggtgtctcctccccttcggtccaacacactttgtatctcagc
gaaaaggaagtgctggatgtcttgccccaagtttccgtcatatcgatgacaatgccgaat
aagcattactttaactttgatacaaaacactttcagaaaatcgttccaggcgacaataat
gaggtgttcatacctgtggataagccacatggtaccatctatgcacaattggctcgaaag
gatttaaggagtcgtctataa

DBGET integrated database retrieval system