KEGG   Drosophila willistoni: Dwil_GK24679Help
Entry
Dwil_GK24679      CDS       T01067                                 

Definition
GK24679 gene product from transcript GK24679-RA
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dwil_GK24679
Transfer RNA biogenesis [BR:dwi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Dwil_GK24679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 550 aa AA seqDB search
MKPKNKLAVGLSREERRILVVGEIIQELLKAHEAKKDVNLNRMKSLISSKYGLDSSPRLV
DIIAAVPQDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLS
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHISDMLNY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVAHMMPDLPNVDFERDI
DQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWRTGRYKSYPPSMLVDLVAKILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTSCRDVRTREVGIQEIHNKVRPY
EIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPELKAVPCSIVRELHV
YGSVVPVNSRDPTKFQHQGFGMLLMEEAERIAREEHCSQKLAVISGVGTRNYYRKMGYEL
DGPYMSKSIV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaaaaaataagttggctgtgggattgagccgggaggagcgccgaattcttgtt
gttggcgaaatcattcaagagctgctcaaagcccacgaagccaagaaggatgtaaatctg
aatcgtatgaagtcgctcatttcatccaaatatggcttggacagttctcccagacttgtt
gatataatagcagctgtaccgcaggatgccaagaagattttgttgcccaaactaagagct
aaaccaataaggacagctagcggtatcgcagtggtagctgttatgtgcaagcctcatcgt
tgcccccacatcaatatgacgggaaacatttgcgtctattgccccggcggaccagacagt
gatttcgaatattctactcaatcctacaccggttatgagcccacttcaatgcgtgccatc
cgcgctcgatatgatccatttctgcagacccgtcatcgtgtggagcaactaaaacaattg
ggtcattcggtggacaaggtggaattcattgtaatgggcggtacattcatgtgtctttca
gaggaataccgcgattacttcatacgaaatcttcatgatgccctatctggtcacagtagt
gccaatgtggccgaagccgttcgctactctgagaaatctcgcaccaaatgcatcggcatt
accatagagacccgaccagattattgcctaaagagacacatttcggacatgttgaattat
ggatgtactcgtctagagattggagtgcaatcggtctatgaggatgtggccagggacaca
aatcgcggacacaccgtccgagctgtctgcgaaagttttcaactgggcaaagatgctgga
tacaaaatagtcgcccacatgatgcccgatcttccgaatgtggattttgaacgtgatatt
gaccagtttattgaatattttgagaatcctgccttccgttcggatggccttaaaatttat
cccacattggtgatccgtggaacaggattgtatgaactatggaggacaggtagatataag
tcatatcccccatcaatgctggtcgacctggtggcaaagattttggctctagtaccgcca
tggacgagggtctatcgggtacaacgagacattccgatgcccttggtaagctctggtgtg
gagcatggaaatttacgtgaattggccctggctcgcatgaaagatctgggaacttcttgt
agggatgttcgtacgcgcgaggtgggcatccaggagatccacaacaaagtacgtccctat
gaaattgagttgatacgacgcgattatgtggccaatggcggctgggaaacatttttatcc
tatgaagatcccgaacaggatatcttagtaggtttgctgagattgcgtaaatgttcgcca
gatactttcaggccagaattaaaggctgtcccctgctctatagtccgtgaacttcatgtc
tacggctcagttgtgccagtcaattctcgggatcccaccaaatttcaacatcagggcttt
ggcatgcttctgatggaggaggctgagcgtatagcacgggaggagcattgcagccaaaag
ttggccgtcatttctggagtaggcacacgcaactattatcgtaaaatgggctatgaactg
gatggcccatatatgtctaaaagtattgtctaa

DBGET integrated database retrieval system