KEGG   Drosophila willistoni: Dwil_GK24691Help
Entry
Dwil_GK24691      CDS       T01067                                 

Definition
(RefSeq) GK24691 gene product from transcript GK24691-RB
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     Dwil_GK24691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 769 aa AA seqDB search
MSNWYRSYTPSWLQRWWHPTPPRRPVNPFRSTRPGPDIENLIDSPILGVQRVDFCLEDNH
DEHHTSHFYAAAAKEALIVRRGEPFRLRIIFHRDYSPSKDAISFIFSVADDSKPSPGHGT
LTALVPHDGIDYLGDSLEWGAGIESHEGQILTVLIKPPATCPVTEWKMDIDTKLLGDGSR
SYPLPLPILILFNPWCPDDQVYMEDRDKRKEYVMHDTTLIWRGSYNRLRPSVWKIGQFER
HVLECSLKLLGTVGRIPPAYRGDPVRVARALSALVNSVDDDGVLLGNWSEDFSGGVAPTK
WTGSAEILQQFHKTQKSVKFAQCWNFSGVLATIARSLGIPARIITCYSSAHDTQASLTVD
VFIDSNNKKLDAETTDSIWNYHVWDELWMQRPDLGIGQFGTYDGWQVVDATPQEPSDNMY
RVGPASVLAVKHGEILRPFDGGFVYAEVNADKLYWRYNGPSQPLKLLRKDTLAIGHLIST
KAVLKWEREDITDSYKYAERTEEERNYMLKALKQSRHAFSRYYLNDNFNDVEFDMELKDD
IKVGESFSVVLKVTNKSEERVHLATGQINCDAILYTGVGAEEVKTMGFELELQPKSSDYV
RMEVIFEEYYGKLSSQAAFQISASAKVKDTDYDYYAQDDFRVRKPDIKFQLGEDSIVAKK
EMDVIVRLTNPLPIPLHKGIFTVEGPGIEQPLKFKIAEVPVGGTAAATFKYIPPYAGRGT
LLAKFSAKELDDVDGYKHYEIEPRPEDALQPNGSHRRSNIIRRRTDVIA
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattggtatcgtagctatacgcccagttggctccaacgctggtggcatcctact
cctccgcgacgtccagtgaatccgtttcgcagcactcgacctggcccagacattgaaaat
ttgatcgattcacctatattgggcgtacagagagttgacttttgcctggaggataatcac
gatgagcatcacacaagtcatttctatgccgcagccgctaaggaggcattgattgtgcgt
cgtggcgaacctttccgtttgcggattattttccatcgcgattatagtcccagcaaggat
gcaatcagtttcattttcagtgtggccgatgatagcaagccaagtcctggacatggaaca
ttgactgcgctggttccgcatgatggcattgattatttgggcgattccttggaatggggt
gcgggcatagaatcgcatgagggtcagattttgacggtcttgattaaaccacctgccact
tgcccggtgactgaatggaaaatggatattgataccaagttgttgggagatggttccagg
agctatcctttacctttacccattcttattcttttcaatccttggtgtcccgacgatcaa
gtctatatggaggatagagataagcgtaaagagtatgtgatgcacgataccactttgatt
tggaggggttcgtataatcggctgagaccttcagtatggaaaataggacaattcgagcgt
catgtcctggaatgcagtttgaaattgctcggaactgtgggacgaatcccgccagcatat
cgtggtgatcctgttcgagtggcacgagccctctccgccctggtcaattctgtagacgat
gatggagtgcttttgggcaattggtcggaggacttttccggtggcgttgcccccaccaaa
tggactggatcagcggagattctccagcaattccataaaactcaaaaatctgtgaaattt
gcccaatgttggaactttagcggtgtcttggccaccatagcccgaagtctgggtattcca
gctcgcattatcacttgttattcttcggctcatgatacccaagcttcgctcacggtggat
gttttcattgattcgaacaataagaaattggacgcggagaccaccgattcgatctggaac
taccatgtgtgggatgaattgtggatgcagcggccagatttgggtattggccagtttggt
acatacgatgggtggcaggtggtcgatgccactccacaagagccttctgacaacatgtat
cgagtgggtcctgcttctgttttggctgtgaaacatggtgagatcctaagacccttcgat
ggtggctttgtctacgcggaggtgaatgcggataagctgtattggcgctacaatggaccc
tcacagcctctgaaattgctgaggaaagacactctggccataggccatttgataagcacc
aaagctgtgctgaagtgggaacgagaagatatcaccgatagctataaatacgccgagcgt
acggaggaggaacgcaactatatgctgaaggctctcaagcaatctcgtcatgcctttagc
cgatattatctgaatgataatttcaatgacgttgagttcgatatggaattgaaagatgac
atcaaagtgggtgagtcattcagtgtggtcctaaaggtcaccaacaagagtgaggagcga
gtccatttggcgactggtcaaatcaattgcgatgccatactctatacgggagtgggagcc
gaagaggtcaagaccatgggcttcgaattggaactgcaacccaagtccagtgactatgtt
cgcatggaagtcatctttgaggaatattatggcaaactctcctcccaggcagccttccaa
atctcagcttcggccaaggtcaaggacacagactatgattactatgcccaagatgatttt
cgtgtacgcaagccggatatcaaattccaactgggtgaggatagcatagtggccaaaaag
gagatggatgtcattgtgagattgaccaatccactgcccattcccttgcataagggcatc
tttactgtcgagggtcctggcattgagcagcccttgaagtttaagattgccgaggtacca
gttggcggcactgcagcagccaccttcaagtatatcccaccctacgctggtcgtggaact
ttgcttgccaaattctccgccaaggaattggacgacgtcgatggctataagcactatgag
attgaaccgcgtccggaggacgcactgcagccaaatggcagccatcgaagaagtaatatc
ataaggcgacgcactgatgttatagcctag

DBGET integrated database retrieval system