KEGG   Drosophila willistoni: Dwil_GK24758Help
Entry
Dwil_GK24758      CDS       T01067                                 

Definition
GK24758 gene product from transcript GK24758-RA
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dwi00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dwi00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dwi00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dwi04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 241 aa AA seqDB search
LFNLIIPLAGICSQSLLTHLVYVISLVSGLNSLTKWIYPEMRPLWRLREGFADDVASRPQ
VALASHELSCETSGGQPCAHSMSFTVLMLVLTSYLLVYCRRNMKWCSISTWRIVACGLIL
SLVIAMWLSRLYLATEFLHQCILGSYFGMRILNCFEKNMNFLYSRRCIWGIILVALLIGL
SVGVYFIKLHFGIDPHWSVRQAFKWCPEPTYMRHEGSPIFLLARDFGNILGISLSLPITK
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ctctttaatctcatcattcctctggctggtatttgtagtcaaagtttactaacacatctt
gtctatgtcattagtctggtcagtggcctgaattcattgacaaaatggatatatccggaa
atgcgtcctttgtggagacttcgtgaaggttttgccgatgatgtagcctctaggccgcag
gttgccttggcaagtcatgaacttagttgtgagactagtggaggacagccttgtgctcat
tccatgtcctttactgtcctcatgctggtattaacatcctacctattggtctattgtcgg
cgtaatatgaaatggtgttcaatcagcacttggcgtattgtggcttgtggattgatatta
tctttggttatcgccatgtggctaagtcgtctatatttggccacagagtttcttcatcaa
tgcatcttgggtagctatttcggtatgcgtatcctgaattgtttcgagaagaatatgaat
tttctatactcacgacgttgcatctggggaattattttggttgccctgttaattggacta
tctgttggtgtttattttatcaaattgcattttggtatagatcctcattggtcggtgaga
caggccttcaaatggtgtccagaacctacttatatgcgtcatgagggtagccccattttt
cttttagcccgagattttggtaatattctgggaatatcgctttccttgcccattaccaag
ttgtaa

DBGET integrated database retrieval system