KEGG   Drosophila willistoni: Dwil_GK24758Help
Entry
Dwil_GK24758      CDS       T01067                                 

Definition
GK24758 gene product from transcript GK24758-RA
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dwil_GK24758
   00052 Galactose metabolism
    Dwil_GK24758
   00500 Starch and sucrose metabolism
    Dwil_GK24758
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dwil_GK24758
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     Dwil_GK24758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 241 aa AA seqDB search
LFNLIIPLAGICSQSLLTHLVYVISLVSGLNSLTKWIYPEMRPLWRLREGFADDVASRPQ
VALASHELSCETSGGQPCAHSMSFTVLMLVLTSYLLVYCRRNMKWCSISTWRIVACGLIL
SLVIAMWLSRLYLATEFLHQCILGSYFGMRILNCFEKNMNFLYSRRCIWGIILVALLIGL
SVGVYFIKLHFGIDPHWSVRQAFKWCPEPTYMRHEGSPIFLLARDFGNILGISLSLPITK
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ctctttaatctcatcattcctctggctggtatttgtagtcaaagtttactaacacatctt
gtctatgtcattagtctggtcagtggcctgaattcattgacaaaatggatatatccggaa
atgcgtcctttgtggagacttcgtgaaggttttgccgatgatgtagcctctaggccgcag
gttgccttggcaagtcatgaacttagttgtgagactagtggaggacagccttgtgctcat
tccatgtcctttactgtcctcatgctggtattaacatcctacctattggtctattgtcgg
cgtaatatgaaatggtgttcaatcagcacttggcgtattgtggcttgtggattgatatta
tctttggttatcgccatgtggctaagtcgtctatatttggccacagagtttcttcatcaa
tgcatcttgggtagctatttcggtatgcgtatcctgaattgtttcgagaagaatatgaat
tttctatactcacgacgttgcatctggggaattattttggttgccctgttaattggacta
tctgttggtgtttattttatcaaattgcattttggtatagatcctcattggtcggtgaga
caggccttcaaatggtgtccagaacctacttatatgcgtcatgagggtagccccattttt
cttttagcccgagattttggtaatattctgggaatatcgctttccttgcccattaccaag
ttgtaa

DBGET integrated database retrieval system