KEGG   Drosophila willistoni: Dwil_GK24872Help
Entry
Dwil_GK24872      CDS       T01067                                 

Definition
GK24872 gene product from transcript GK24872-RA
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dwi  Drosophila willistoni
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dwil_GK24872
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dwil_GK24872
    2.7.1.82  ethanolamine kinase
     Dwil_GK24872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 569 aa AA seqDB search
MRQRNRSNKNKKNHRQQQHQQVQQIERNCCIRNRCKYEQIWQHFRRNATLEEIRHAAARI
CRDYLTGRWKVVTPESLIVKRISGGLSNFLYYVSLPDLDDFDEQQLQANVNVAKDVIAST
TTLSKNSNKLYTRDEVVVDALAVDRKETTLGHKNAAAASPVVDDDDDAAISAKQAHKRQR
FDSDSGDSSSLKRLHAPKQEPREVLLRIYGQTHGDHALESMITESVVFALLSERNFGPKL
HGIFPGGRIEQYIPARSLATTEMGEARISMKIAEKMGEIHSLNIPMSKEPDWIWNCMNRW
LASLDSIVKGKIESKPNSSVLHKQRDLMRTIDYVKEMAWLRSVIEKGVYPVVFCHNDLQE
GNILLRQPTAGQGERTPRISLSSLRSNFDETLGDSLDGNSNISEPDVNRKSSRASSPCAE
LDTTDDSALDASFTLDNEPDLIIIDFEYCAYNYRGFDLANHFIEWTFDYTNPQFPYFHHY
KHQYATEQQRRDFIVNYLKKYHDDENYEPTVEELDQVDGEIQFFTMFSHLFWSLWSVVNV
TSAIEFGYWEYGVARILEYQQLKAAYLAK
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacgaaatcgtagtaacaaaaataagaaaaatcatcgccaacaacagcatcag
caagtgcaacaaattgaacgaaattgttgtatacgcaatcgttgtaaatatgaacaaatt
tggcaacattttcgacgaaatgccacactcgaggaaattcgccatgcagcggcacgcatt
tgccgtgactacctaaccggacgttggaaagtagtgacccccgagtcgttgatagtaaaa
cgcatcagtggcggtctatctaactttttatattacgtaagtctgcccgacttagatgac
ttcgatgaacagcagctgcaggcaaatgtcaacgtggccaaagacgtcatagccagcacc
acaactttgtctaagaatagcaacaaactgtatacacgcgatgaggtggttgtagatgcg
ttggcggtggacagaaaggagaccacattgggacataaaaatgctgctgctgcttcgcct
gtggttgatgatgatgacgatgcggcgattagcgccaagcaggcacataaacgtcaacgt
ttcgatagcgacagtggcgattcgagttcattgaaacgtttgcacgcccccaagcaagag
ccgcgtgaggttctactgcgtatttacggtcagacacatggcgatcatgcgctggagagt
atgatcaccgaatcggttgtatttgcattgcttagtgagcgaaatttcggacctaaattg
catggcatatttcctggtggacggatcgagcaatatataccggcacgttctttggccact
acggaaatgggtgaggcacgcatatcaatgaaaattgccgagaaaatgggtgaaattcat
agcctaaatataccaatgtcaaaggaaccagattggatctggaattgtatgaaccgttgg
ctggccagcttggatagcatagtgaagggaaaaattgaatcgaaaccaaattcaagtgtt
ttgcataagcaacgtgacttaatgcggaccattgactatgtcaaggaaatggcttggttg
agatcagtgatcgagaaaggtgtttatcctgttgtattttgtcacaatgatctgcaagag
ggtaatatattattgcgtcagccaacggctggtcagggtgaacgaacgccgcgaatttcg
ttaagtagtctgagatccaactttgatgagacattgggtgatagtttggatggcaatagt
aatatctctgagcctgatgtcaaccggaaatcgtcacgtgcctcatcgccctgcgccgag
ttggacacaacagatgattctgccctggatgccagtttcacattggataatgagccggat
cttattatcattgattttgaatattgtgcctataattatcgtggtttcgatttggccaat
catttcattgaatggacctttgactataccaatccacaattcccatactttcatcattat
aaacatcaatatgccactgaacaacagagacgtgattttattgtcaactatttgaagaaa
tatcacgatgatgagaattacgagccaacagttgaggaattggatcaagtcgatggcgaa
atacaattcttcaccatgttttctcatctattttggagtctgtggtcggtggtaaatgtg
acatcagccattgagtttggttattgggaatatggcgtagcacgaattttggaatatcag
caattgaaggcagcctatttggccaaatga

DBGET integrated database retrieval system