KEGG   Drosophila willistoni: Dwil_GK24872Help
Entry
Dwil_GK24872      CDS       T01067                                 

Definition
GK24872 gene product from transcript GK24872-RA
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dwi  Drosophila willistoni
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dwi00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 569 aa AA seqDB search
MRQRNRSNKNKKNHRQQQHQQVQQIERNCCIRNRCKYEQIWQHFRRNATLEEIRHAAARI
CRDYLTGRWKVVTPESLIVKRISGGLSNFLYYVSLPDLDDFDEQQLQANVNVAKDVIAST
TTLSKNSNKLYTRDEVVVDALAVDRKETTLGHKNAAAASPVVDDDDDAAISAKQAHKRQR
FDSDSGDSSSLKRLHAPKQEPREVLLRIYGQTHGDHALESMITESVVFALLSERNFGPKL
HGIFPGGRIEQYIPARSLATTEMGEARISMKIAEKMGEIHSLNIPMSKEPDWIWNCMNRW
LASLDSIVKGKIESKPNSSVLHKQRDLMRTIDYVKEMAWLRSVIEKGVYPVVFCHNDLQE
GNILLRQPTAGQGERTPRISLSSLRSNFDETLGDSLDGNSNISEPDVNRKSSRASSPCAE
LDTTDDSALDASFTLDNEPDLIIIDFEYCAYNYRGFDLANHFIEWTFDYTNPQFPYFHHY
KHQYATEQQRRDFIVNYLKKYHDDENYEPTVEELDQVDGEIQFFTMFSHLFWSLWSVVNV
TSAIEFGYWEYGVARILEYQQLKAAYLAK
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacgaaatcgtagtaacaaaaataagaaaaatcatcgccaacaacagcatcag
caagtgcaacaaattgaacgaaattgttgtatacgcaatcgttgtaaatatgaacaaatt
tggcaacattttcgacgaaatgccacactcgaggaaattcgccatgcagcggcacgcatt
tgccgtgactacctaaccggacgttggaaagtagtgacccccgagtcgttgatagtaaaa
cgcatcagtggcggtctatctaactttttatattacgtaagtctgcccgacttagatgac
ttcgatgaacagcagctgcaggcaaatgtcaacgtggccaaagacgtcatagccagcacc
acaactttgtctaagaatagcaacaaactgtatacacgcgatgaggtggttgtagatgcg
ttggcggtggacagaaaggagaccacattgggacataaaaatgctgctgctgcttcgcct
gtggttgatgatgatgacgatgcggcgattagcgccaagcaggcacataaacgtcaacgt
ttcgatagcgacagtggcgattcgagttcattgaaacgtttgcacgcccccaagcaagag
ccgcgtgaggttctactgcgtatttacggtcagacacatggcgatcatgcgctggagagt
atgatcaccgaatcggttgtatttgcattgcttagtgagcgaaatttcggacctaaattg
catggcatatttcctggtggacggatcgagcaatatataccggcacgttctttggccact
acggaaatgggtgaggcacgcatatcaatgaaaattgccgagaaaatgggtgaaattcat
agcctaaatataccaatgtcaaaggaaccagattggatctggaattgtatgaaccgttgg
ctggccagcttggatagcatagtgaagggaaaaattgaatcgaaaccaaattcaagtgtt
ttgcataagcaacgtgacttaatgcggaccattgactatgtcaaggaaatggcttggttg
agatcagtgatcgagaaaggtgtttatcctgttgtattttgtcacaatgatctgcaagag
ggtaatatattattgcgtcagccaacggctggtcagggtgaacgaacgccgcgaatttcg
ttaagtagtctgagatccaactttgatgagacattgggtgatagtttggatggcaatagt
aatatctctgagcctgatgtcaaccggaaatcgtcacgtgcctcatcgccctgcgccgag
ttggacacaacagatgattctgccctggatgccagtttcacattggataatgagccggat
cttattatcattgattttgaatattgtgcctataattatcgtggtttcgatttggccaat
catttcattgaatggacctttgactataccaatccacaattcccatactttcatcattat
aaacatcaatatgccactgaacaacagagacgtgattttattgtcaactatttgaagaaa
tatcacgatgatgagaattacgagccaacagttgaggaattggatcaagtcgatggcgaa
atacaattcttcaccatgttttctcatctattttggagtctgtggtcggtggtaaatgtg
acatcagccattgagtttggttattgggaatatggcgtagcacgaattttggaatatcag
caattgaaggcagcctatttggccaaatga

DBGET integrated database retrieval system