KEGG   Drosophila willistoni: Dwil_GK25029Help
Entry
Dwil_GK25029      CDS       T01067                                 

Definition
GK25029 gene product from transcript GK25029-RA
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1322 aa AA seqDB search
MSSPDDRIPIRHDLPSEAGNDERLLRMSSGVLTLDYKPHPAADIDQQIMELKKNQELQKQ
RLFDTFQEQTKQMELEHKLQLQHKYQIAVHSHGAYQELREQHETMPQPVNVAEEQQHQHH
RQQQQQQQQQQREQQQQQQHQQQQQQQQQQQQQHQREQQRDRREREVMKRKENCSANASP
EVKQLLNYFIMSRKSQAAASNGTTTTSPYRNRGVVKSSSGESLPAGTVTSAHPYKIPQPP
PPTLLKYDSDFPLRKTASEPNLLKIRLKQSVIERKARIGGPAGARRHERLLQAAQRRQQK
NSVLTNCNSTPDSGPNSPPNNSQSTLAVGVVGSRGSPTSAPIQEEHEEEGIQYQPGQRSS
INDLPLFSSPSLPNISLGRPHLPHTNSNQAQAAAAATVAQAASAAHVNYAMFAALQQHVA
TGGGVGVGVGVGAAPPTYYNPLGLPFGRQPPTAAAAAAAAAAAASAGPLGMMPATGIAPQ
QPSPVVRSASATSTSSSQASLVGDVAPPQAHAASSILPSSSSSYLHGGLANSTVNLHAAA
MAAAAAAAGTLPPTNSHALYAAAAAAVAASGGGGGGGGAGGSGSSGAGSGHHPPHSTPIT
DSQVAQVHLHKQGHRPLGRTQSAPLPLGHPMLTGSSQLSVVQTHYENSEAERQAYEHQVL
TQKLRQAVLTRSGAVVREQPQLKEEDDSSAEVMDLTDKKKPPKTVLTTTIATSTSQNLPE
ALAAATAAAALTGGSSAAITCPVGYRAAPIGGGKSASKSRDQEYLQQQRELLYLQEEELA
KVVMRPLSRTLSSPLVPLGPHGLSQIPDTGQQPTPIATSSSADHIPPVNLSLPHRRQFLG
SGSAATAAAAVYAAQMRQQQQQHPHPHTSTAATSPPLSSNNSTSNSKHKITTGLAYDPLM
LKHSCICGDNSLHPEHSGRLQSVWARLNETDLVKRCDRLRARKATQEELQTVHTEAHAML
FGSNQCQLSRPKLESALSASFVRLSCGGLGVDLDTTWNEHHTATAARMAAGCVIDLAFKT
AKGDLRNGFAVVRPPGHHAEANLAMGFCFFNSIAIAAKLLRQRLPEVKRILIVDWDVHHG
NGTQQAFYQSPDILYLSIHRHDDGNFFPGTGGPTECGAGAGLGFNVNISWSGALNPPLGD
AEYIAAFRTVVMPIAKYFNPDIILVSSGFDAATGHPAPLGGYHVSPACFGYMTRELLQLA
NGKVVLALEGGYDLAAICDSAQECVRALLGDPAAPIAKTELERPPCQNAINTLQRTIAIQ
QTHWPCVRLLEHTVGLSALDALKIEHDESETVNAMAGLSMQSLHRTLSRDDSEEPMDQDE
TK
NT seq 3969 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtcctgacgatagaataccaatacgtcatgatctgccatcggaagccggaaat
gatgagcgcttacttcgcatgtcatcgggcgttttgactttggattataagccacatcca
gcggctgatatcgatcagcagatcatggagctcaaaaagaatcaggaattgcaaaaacaa
aggctatttgacacatttcaggaacaaacgaaacaaatggaactggagcataaattgcaa
ttgcagcacaaatatcaaattgcggtgcattcacatggcgcataccaggaattgcgggaa
caacatgaaacaatgccacagcctgtgaatgttgccgaagagcagcaacatcaacatcat
cgtcaacagcagcagcagcagcaacaacaacaacgtgaacaacaacaacaacaacaacac
cagcagcagcagcaacaacaacaacaacaacagcaacaacaccagcgggaacaacaacgc
gatcgtcgtgaacgggaagtgatgaagcgtaaggagaattgtagcgccaatgccagtccc
gaagtcaaacagcttctcaattactttattatgagtcggaaatcgcaggcggctgcatcg
aatggcacaacaacaacatcaccctatcgtaatcgtggcgttgtcaaaagctcatcaggt
gaatccttgccagcgggcactgtgaccagtgcgcatccttataaaatacctcaaccgccg
ccaccaacactgctcaaatatgattctgattttccactcagaaagacagcatccgaacca
aatctgctgaagatacgccttaaacagagtgttatagagcgtaaggctaggattggcggt
ccagctggagcacgacgacatgaacgcctcttgcaggcggcacagcgtagacagcaaaag
aattctgttttaacaaactgcaatagcacacctgattcggggccaaactcaccgccaaat
aactcgcaatccactttggctgtcggcgttgttgggagtcgcggctcaccgaccagtgca
cccatacaggaggagcacgaggaggagggcatacaatatcagccgggccaacggagcagt
atcaatgatttgccattgtttagttcgccatcattgccgaatatctcactgggacgtccg
catttaccccatacaaatagcaatcaggcacaagccgctgccgccgccacagtcgctcag
gcggcatcggcggcccatgttaactatgccatgtttgctgccctccaacagcatgtggca
actggtggcggtgtcggtgtcggtgtcggtgttggagccgccccacccacatactataat
ccattgggtctgccatttggtagacaaccaccaacggcggcagctgcagcagcggcggcg
gcggcggcggcgtcagctggcccattaggaatgatgccagccacgggtattgcaccgcaa
caaccatcgccagtggtgcgatccgcatcggccacatccacatcatcgtcgcaggcatcg
ttggtgggtgatgtagcgccgccgcaagcccatgccgcctcctccatactgccatcatcg
tcgtcgtcgtatctgcatggcggtctggccaattcgactgttaatctccatgccgctgcc
atggctgcggcggcggcagcagctggcacattgccgcccacaaatagccatgccctgtat
gcagctgccgcggctgctgttgctgctagtggtggtggtggtggtggtggtggtgctggt
ggtagtggtagtagtggtgctggtagtggtcatcatccgccacatagcacacccataaca
gattcccaagtggcgcaagtgcatcttcataagcagggccatcggccattgggcagaaca
caatcagcacccctgcccctgggtcatcccatgttaacaggttccagtcagttgagtgtg
gtgcaaactcactacgagaatagcgaggcggaacgtcaagcatatgagcaccaggtgctt
acccagaaactacgtcaagctgttctcacacggagcggggccgtggtacgggagcagcca
cagctcaaggaggaggacgattcctcagccgaggtcatggacttgaccgacaaaaagaaa
ccgcccaaaacagtcctaaccacaactatagccactagcacatctcagaatctgcccgaa
gcgttggcggcggccacagcagcggctgcgcttacgggtggttcctctgccgctattacc
tgcccggtaggttatcgagccgctccgattgggggcggcaaatcagctagcaaatcccgc
gatcaggaatacctgcaacaacagcgggagttgctctatctgcaggaggaggaattggcc
aaagtcgtgatgcgtccattgtcacgcacattgagcagtccattggtgccattggggcca
catggtctcagccagataccagacactgggcaacagccaacacccatagccacctcatcg
tcggctgatcacataccgcccgtcaatctatccctgccacatcggcgtcagtttctgggc
agcggttcggctgccaccgccgctgccgctgtctatgcggcccagatgcgtcagcagcag
caacaacatccacatcctcatacatcgactgcggccacatcgccgccactttccagcaac
aattcgacatccaactccaagcacaagatcaccactggcctggcctacgatccattgatg
ttgaagcacagctgcatctgtggcgacaactcactgcatccggagcacagtggacgtctg
cagagtgtttgggcgcgtcttaacgaaacggatctggtgaagcgttgcgatcgattgcgt
gcccgcaaggccacccaggaggaactgcagacagtccacacagaggctcatgccatgctc
tttggctccaatcagtgtcagctgagtcgtcccaagctggagagcgccttgtccgccagt
tttgtgcgtctatcctgcggtggattgggtgtcgatctcgataccacatggaatgagcat
catacggccactgcggcccgcatggctgccggctgtgtcattgatttggcctttaaaacg
gccaagggcgatttacgcaatggtttcgctgtcgtccggccacccggccatcacgctgag
gccaatttggccatgggcttttgtttctttaattcgattgccattgccgcgaagctgctg
cgtcagcgtttgcccgaagtgaaacgcattctgattgtggattgggatgttcatcatggc
aatggcactcagcaagcattctaccaaagtcccgacattctatacctttccatacatcgc
cacgatgatggtaatttctttcccggcacaggcggtcccactgagtgcggcgctggtgct
ggtctcggcttcaatgtgaatatctcatggtctggcgccttaaatccaccgctgggcgat
gccgaatatattgctgcattccgtaccgttgtgatgcccattgccaagtactttaatccg
gatattattcttgtctcatctggttttgatgctgcaaccggtcatccagctcccctcggt
ggctatcatgtgtcgccagcttgctttggctatatgacacgcgaattacttcaattggcc
aatggcaaggtggtcctggctcttgagggtggctatgatctggcagccatatgtgattcg
gcccaagagtgtgttcgcgcattgctgggcgatccagcggcacccatagccaaaacggag
ctagaacgaccgccatgtcagaatgccatcaatacattgcaacggacaatagccatccag
caaacacattggccctgcgtacgattattggagcatacagtcggactctcggccctggat
gctctcaagattgagcacgatgaatctgaaacggtcaacgccatggccggtctatctatg
cagtcactgcatagaacgctctcccgcgatgattcggaggagccgatggatcaggatgaa
accaaatag

DBGET integrated database retrieval system