KEGG   Drosophila willistoni: Dwil_GK25042Help
Entry
Dwil_GK25042      CDS       T01067                                 

Definition
GK25042 gene product from transcript GK25042-RA
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dwi  Drosophila willistoni
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dwi04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1174 aa AA seqDB search
MEIETDQSIEAMDTQDTQEVEIITSDLQQQQQQQQQQQQKQNSPPQLPKFKNLIQPTGQL
HAVGAVTQLAAPPPPPPPSENGNVPPQQLLADSSSTSFGPDPQDQHPGAMAMEDESTKED
QFRSETTFSYTVENVNQLKAQRLSPPVYVRMLPWKIMVIPNDRALGFFLQCNGENDSPTW
SCNAIAELRLKCHKPDAQPFTRARIKHLFYSKENDYGYSNFITWQELQDADKCYVLNNSI
TLEVHVIADAPHGVLWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNSLRLAVYRIPTEA
DDSTKSVGLSLQRVFHELQFGDRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLES
KMKGTCLEGTIPGLFEGKMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVA
SETLEGDNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPITDSSIKYNDRFEFYE
QINLDRYLADREKTPADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRK
QEAIEQNYGGMDDEISFHAKCSNAYMLVYIRQSELDRVLGDIPENEISSDLVERLDLEKR
IEMARRKERSEANLYVSVHVILEEYFEGQQKRRLFDLEKTHQRPFKLKQNQTVDELVEMF
VKGFGVPRNRMRIWNMCTAQTQKFLHFDFEAEGGRTIEQIPTSQKPWVVFLELASPELSP
DAPLPPFNPKTDVLLFLKYYDARNKRLNYIGCTQQPQTRRLIELVPEVNLKLGFDLDTEL
TIFDEYADKKVINLHDPIESVLYIPQDHLQGHILIFERELVDMKLDLPTVEDYFLDLVYR
IEIVFSDKCNPNEPDFTLELSNRYNYEQLTNAVAERLNTDPQKLQFFMCINNYKETAGNA
VPYTFKGTIKDLVSYTKQSAPKRIFYQRLSLSIHELDNKKQFKCIWVSNDLKEEKELVLY
PNKNDTVKGLLDEAAKKITFSENSRKKLRLMKVSNHKIVALCKDDVALETLLKNSDSITT
TQNAGGGAGAGGGGGAGGGANSGAQKTYRIEEIPADEMQLAENEFLIPVAHFSKELYNSF
GVPFLTKARQGEQYKELKQRIQKRLNVPDKEWENYKFSIISMGLIGDVNDNSLVDLEIYR
SSNGQSPFFGLDHINKSRKRSSLNFSEKAIKIYN
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgaaacagatcaatcgatagaagcaatggacactcaggatacccaagaggtt
gaaattatcacaagtgacctacaacaacaacagcagcagcagcaacaacaacaacaaaaa
cagaattctccgccacaattgccgaaatttaagaatcttatccagccgacgggtcagttg
catgctgttggggcagtaacccaattggcagctcctccaccaccaccgccaccaagtgaa
aacggtaatgtgccgccacagcaactgctagccgatagcagttccacatcgttcggtcca
gatccacaagatcagcatcccggagcaatggcaatggaagatgaatcaaccaaggaggac
caattccgttcggaaacgaccttctcatatacagtggaaaatgtaaatcaattgaaggcc
cagagactctcaccaccggtctatgtacgaatgttgccatggaaaataatggtcataccg
aatgatcgtgcattgggcttctttttgcaatgcaatggtgagaatgattcccccacatgg
tcatgcaatgccatagctgagctgcgtctcaagtgccacaagccggatgcccagccgttc
actagggccagaatcaagcatttgttctattccaaggagaatgattatggttattcgaat
ttcattacctggcaagagctacaggatgccgacaaatgttatgtattgaataatagcatc
accttggaggtgcatgtcattgcagatgccccacatggagtactgtgggactccaagaag
cacaccggctatgtgggcctcaagaatcagggggccacatgctatatgaactcactgctg
cagacactctacttcacaaattccttacggctagctgtctatcgcatacccacagaggcg
gatgacagcactaaatcagttggtctctccttgcaaagggtattccatgagctgcagttc
ggtgatcgtccggtgggcaccaaaaagctaaccaaatcctttggctgggagacactcgac
tcgtttatgcaacacgatgtccaagaatttttgcgtgttcttctcgacaagcttgagtcg
aagatgaagggtacctgcctggagggcaccataccaggtcttttcgagggcaaaatgtct
tcatatattaaatgcaaaaatgtcgactataattcaacacgctacgagaccttttatgac
attcaattaaacatcaaagataagaagaacatctatgaatcctttcaggattatgttgcc
tctgaaactctggagggcgataataaatacgatgctggtgtccatgggctacaggaggct
agcaagggagtgatattcacctcattcccacccgtgttgcatttgcatctgatgcgtttc
caatatgatcccataacggacagttcgattaagtacaatgatcggtttgagttctatgag
caaatcaatttggatcgctatttggccgatcgtgaaaaaacacccgccgactatgtcctt
catgctgtactcgtccattcgggcgacaatcatggtggtcactatgtggtcttcattaat
ccaaaagcggatggccgttggtttaaattcgatgatgatgtggtatccagttgccgcaaa
caggaggccattgaacaaaactatggcggaatggatgatgaaatctcttttcatgccaaa
tgcagcaatgcctatatgttagtctatatccggcaatcggaattggatcgcgttttgggc
gatattcccgaaaatgagatatccagcgatttggttgagcgacttgatctcgaaaagcgg
atcgagatggcccgtcgcaaggagcggagcgaagccaatctatatgtttcggttcatgtc
atcctggaagaatatttcgagggtcagcagaagcggcgtctctttgatctagagaaaaca
catcagaggccctttaagctcaagcaaaatcaaacagtcgacgaattggttgaaatgttt
gtcaagggattcggtgtgccacgcaatcgtatgcgcatctggaatatgtgcacagcccag
acacagaaattcctgcattttgattttgaggccgagggtggacgcaccattgaacagata
cccacctcacagaagccctgggtggtgttcctagaattggcatcgccggaattatcaccg
gatgcgccgttgccaccatttaatccaaaaactgatgtacttctgttcctcaagtactat
gatgctcggaataaacgacttaattatattggatgcactcagcagccacagacacggcgt
ctaattgaattggtgcccgaggtgaatcttaaattgggcttcgatctagataccgagctg
accatcttcgatgagtatgccgacaagaaggtgatcaatctgcatgatcccattgaaagt
gtgctctacataccgcaggatcatttgcaaggacatatattgatatttgaacgagaactg
gttgacatgaaacttgatctgccaactgtcgaggactatttcttagatcttgtgtatcga
attgaaatcgtatttagcgacaaatgtaatcccaatgaacccgattttacgctggaatta
tccaatcgatataattatgagcaactaaccaatgctgtagccgaacgactaaataccgat
ccccaaaaattgcaattctttatgtgcatcaacaactataaggagacggcaggcaatgct
gtgccgtatacatttaagggcaccattaaggaccttgtgtcgtataccaaacagagcgca
ccgaaacggatattctatcaaagattatcgctaagcatccatgaactggacaataagaaa
caattcaagtgtatttgggtatcgaatgaccttaaggaggagaaggagctggtactctat
cccaataagaatgacactgttaaaggattgctcgatgaggcggccaagaagattacattc
tcggagaatagccgtaaaaaattgcgcctcatgaaggttagcaatcataaaattgttgcc
ctttgcaaagatgatgttgccttggaaacgctgctcaagaatagcgattcgataaccaca
acgcaaaatgctggcggcggtgctggtgctggcggcggtggcggcgccggcggtggagca
aatagcggtgcacaaaaaacttatcgcattgaggaaataccggccgatgaaatgcaattg
gcggaaaatgaattccttataccggtggcgcatttcagcaaggaattgtacaattcattt
ggtgtaccatttctaaccaaggcgcgtcagggtgagcaatacaaggagttaaagcaacgc
atccaaaagcgtctcaatgtccctgataaggagtgggagaactataagttttccattatc
tcgatgggcttaattggtgatgttaacgataattcgctagtagatttggaaatctatcga
tcctctaatggacagtcgccgttctttggcctcgatcacataaataagtcacgtaaaaga
agttcgcttaatttctccgagaaggcaatcaagatatataattaa

DBGET integrated database retrieval system