KEGG   Drosophila willistoni: Dwil_GK25059Help
Entry
Dwil_GK25059      CDS       T01067                                 

Definition
GK25059 gene product from transcript GK25059-RA
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
dwi  Drosophila willistoni
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dwil_GK25059
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Dwil_GK25059
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dwil_GK25059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1281 aa AA seqDB search
MSCFSAMNTPLLGEMEQTIGMLERGTIVTKLYGKQRRPDRRHLMLIRETRQLLWSTVAAH
TPRTDYEGALQLREIREIRVGKNSKEFRLHADECQRFEPSKCFVILYGNHFKLKSFSVVA
LSEVEADNWVRGLRYMVKDTINAPYPLQIDRWLRREYYQIENVNASHSSNKSSSSSSSTT
AAAEHHSQTQVTIKDFKMFLSSVSCKMTTSKFMEYFTDDVRRKHDLKFDDFSRLYQRLLL
PINFVNLLCPTSQLGPNQFAYSEDHQTVRALEFKRFLDIEQRSGNGGGGGSGGGGSGGGG
ELSFISNFIRDFVQDVERDVQEPYLSISEFVDYLFSKQNDLWDSKYDAITMDMSQPLSSY
WIASSHNTYLTGDQFSSESSCEAYARALRMGCRCIELDCWNGPDNLPYIFHGHTMTSKIK
FMDVIKTIKDHAFTTSEYPVILSIEQNCSLEQQRNMAQALLEVFGDLLLTQPCDRNEVHL
PSPHQLRRKIILKHKKLPQFDENFSGVNVGGVGGITNGTLGHRSSLTGGQNADPSNESND
NAMRKVLKEGLLYFKDPVDKSWNLYQFVLTQQELIYSSEINESRNGNSEDDEFGLSTSSS
CNQLNTQTQMQQKQKDSSANDELHFGENWFHGKLEGGRQEADQLLETYKHLGDGTFLVRE
SATFVGDYSLSFWRRNRANHCRIKLKHENGTIKYYLVENFVFDSLYSLIVYYRKNMLRSS
EFSIILKEPVPQPKKHESQDWFHPNTTKEQAEQGLFRLDIGSFLVRPSVQSMNAFVISFT
INRKIKHCRIIQEGRLYAIDTMQFESLVSLIHYYMRNPLYRNVKLVHPVSQDLLRQTLHD
NAQLQGAEHSSGGDNGASNYMGSHLEEYVTCKALYSYKADKPDELSFPKHAIITNVQRNN
SMWWRGDYGGMIQQHLPANYVKVIDSATEDYNSVNEEGGGTDGRTDSIEIYGAVASLFES
NEPGIIIKLQIQTPTTQNPFVIGFDNQETAYEWIKAIQDATLIATQLATERRKKERTARV
AKEMSDLIIYFRSVPFRDHSWIFQEMSSFPETKAEKQFFQQNTQLFLSYHRNQISRVYPK
GQRLDSSNFNPVPFWNIGSQMIALNYQTGDKAMQLNQAKFRNNGQCGYILKPSFMKLDSF
NPNNSQCDGLSEVKITIRLIAARHLFRGGKSNNPQIVVEICGASYDSGIKYRTKVNENGF
NPVWNESCDFNIRNPQFALLRFELQDEDMFAETHFIAQACYPLTCVRQGYRSVILRNKFS
EELELSSLLVHINIAHISSTT
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcttcagtgcaatgaatacgcctctgctgggcgaaatggaacagaccattggc
atgctggagaggggtacaattgtaacaaagttatatggaaaacagcgtcgtccggatcgt
cgccacctaatgcttatacgagagacacgccagctgttatggtcaacggtggcggcccat
acaccgcgaacggattacgagggtgccttgcaattgcgagaaatccgtgagatacgtgtg
ggcaagaattctaaggagtttcgtttacatgccgacgaatgccaacgctttgagccgagc
aaatgttttgttatactttatggcaatcattttaagctaaagagcttttcggtggttgcc
ctctcggaggtggaggccgacaattgggtccgtggtctccggtatatggttaaggataca
atcaatgcaccatatccattgcaaattgatcgttggctacgtcgtgaatactatcaaatc
gagaatgtcaatgcatcgcattcgtccaataagtcatcgtcatcatcatcatcgacaaca
gccgcagcggagcatcattcccagacccaggtcaccattaaggatttcaaaatgttccta
agcagtgtcagctgtaagatgaccactagcaaatttatggaatactttacggatgatgtg
cgacgcaagcatgatttgaaattcgatgatttttcacgtctctatcagcgtcttttgctg
cccattaatttcgtaaatttactgtgtcccacgtcacagttagggccaaatcaattcgcc
tattccgaggatcatcagacagtgcgtgcccttgagtttaaacgatttctggatattgaa
cagcggtcaggaaacggcggcggcggcggctctggcggtggcggctctggcggtggcggc
gaattgagtttcatatcgaatttcattcgagattttgtacaggatgttgaacgtgatgtt
caggaaccgtatctatccatatccgaatttgttgactatttattttcgaaacagaatgat
ttatgggatagcaaatacgatgcgattaccatggatatgagtcagccgctttcatcctat
tggatagcctcgtcgcacaatacgtaccttacgggtgatcagttctctagtgaatcctca
tgcgaggcctatgcccgggcattaaggatgggctgccgttgtattgaactcgactgttgg
aatggaccggataatttaccctatatatttcatggtcataccatgacatcaaaaattaaa
ttcatggatgtaatcaagacaattaaagatcatgcctttaccacatcggaatatccggtt
atactttctattgaacagaattgttccctggaacagcagcgcaatatggcacaggccctg
ctcgaggtctttggagatttgttgctcacccagccatgtgaccggaatgaggtgcattta
ccatcaccccatcagctgcgccgtaaaataatattgaaacataagaaattgccacaattc
gatgagaatttcagtggtgttaatgttggaggcgttggtggtattaccaatggaacattg
ggccatcgatcctcattgactggcggacagaatgccgatccaagcaatgagagcaacgac
aatgcaatgcgcaaggtgttgaaggagggtctactatattttaaggatccagttgataaa
tcctggaatctctatcaattcgtgttgacccaacaggaattgatctattcatcggaaatc
aatgagagtcgcaatggtaattccgaagatgatgaatttggtctctcaacatcatcgtca
tgcaatcaactaaacacccagacacaaatgcagcaaaagcaaaaggactcttcagccaat
gatgagctgcattttggtgaaaattggtttcacggcaaattggaaggtggacgacaggag
gcagatcaattgctggaaacgtataaacatctgggtgatggaacatttcttgtccgcgaa
tcggccacatttgtgggcgactatagcctctcgttttggcgtcgcaatcgagccaatcat
tgtcgcattaaattgaaacacgagaatggcacaattaaatattatttagttgagaatttt
gttttcgattcgttatattcattaattgtctactatcgcaaaaatatgctgcgtagctct
gagttttcaattattctcaaagaaccagtaccgcagccaaagaagcatgagagccaagat
tggtttcatccgaatacgaccaaagagcaggccgaacagggtctttttaggctagacatt
ggttcgtttttggtgcgaccatcggtacagagtatgaatgcttttgttatatcgtttacg
attaatcgaaagataaaacattgtcgcatcatacaagagggtcgtctgtatgccatcgat
accatgcaatttgaatcgcttgtatcgctcatccattactatatgagaaatcccctctat
cgcaatgtaaagcttgtgcatcctgtttcccaggatttgctgcgtcagacactccacgat
aatgcccaattgcaaggggctgaacatagtagtggtggtgataatggagcctccaactac
atgggctcccatctggaggaatatgtaacctgcaaggctctgtatagctataaggccgat
aagccagatgaattgtcattccctaagcacgcaattatcacgaatgtacaaaggaataac
tcaatgtggtggcgtggtgactacggtggcatgatacagcagcatttgccagcgaattac
gtaaaggtaattgattcggccacagaggattacaattcggttaatgaggagggaggcggt
actgatggacgcaccgattcgattgaaatctatggagctgttgcctctctattcgaatcg
aatgagccgggcattataattaaattgcaaatccagacaccaaccacacagaatcctttt
gtcatcgggtttgataaccaagagacggcctatgagtggattaaggccattcaggatgca
actcttatagccacccagttggccaccgaacgtcggaagaaagaacgcactgctcgcgtt
gccaaggagatgtccgatttgattatctattttcgcagtgttccattccgtgatcattca
tggatattccaggaaatgtcaagtttccccgagacaaaagcggaaaaacaattcttccag
cagaatacccaactctttttatcctatcatcgcaatcaaataagtcgagtgtatccaaag
ggtcagcgtttggattcatcgaattttaatccagtaccattttggaatattggatctcaa
atgattgcattgaattatcaaactggtgacaaagccatgcagctaaatcaggccaaattt
cgtaataatggacaatgtggctatatattgaagccatcctttatgaaattggatagcttt
aatcccaacaattcgcaatgtgatgggcttagtgaagtaaagattacaattcgtttaatt
gcggcacggcatctatttcgcggtggcaaatcgaacaatccacaaattgttgtcgaaatc
tgtggcgccagttatgacagcggcattaaatatcgtaccaaggtcaatgaaaatggcttc
aatccggtatggaatgagtcctgtgactttaatatacgcaatcctcagtttgctttgctc
cgttttgaattgcaagacgaggatatgtttgctgagacacattttattgcccaggcatgc
tatccgttaacatgtgtccgccaaggatatcgcagtgtaattttgcgtaataaatttagc
gaagagttggaattgtcttcgttattagtacatataaatattgcacatatctcatcgact
acatag

DBGET integrated database retrieval system