KEGG   Drosophila willistoni: Dwil_GK25111Help
Entry
Dwil_GK25111      CDS       T01067                                 

Definition
GK25111 gene product from transcript GK25111-RA
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dwi  Drosophila willistoni
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:dwi04013]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dwi04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:dwi04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 397 aa AA seqDB search
MSKNKLNLVLPPVNTDSTVAAAQVAPTPPFKTPSGTETHSLLGKPKTSIDALTETLEGLD
MDDTERKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPDTVTMEAIFAENSDG
DGNQTVLEPKVMAIFELLDYIVNEPPPKLEHKIFSDEFKDFVDICLKKQPDERADLKTLL
SHRWIRKAELEEVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaacaagctgaacctggtactgccgccggttaatacggattcaactgttgcg
gcagcccaagtggcaccaacaccaccattcaaaactccatcgggaacagaaacacatagt
ttgctgggcaagccaaagacgagcatcgatgccttaacggaaactctcgagggcctagac
atggacgacacggaacggaaacggatcaaagtgtttctcagtcaaaaggaaaagatcggt
gaactgtcagatgaagatttggagaaattgggcgaacttggctctggaaatggcggagtc
gtaatgaaagtccgtcatacgcacacacatctcataatggcacgaaaactgattcatctt
gaggtgaaaccggcaattaagaagcaaatccttcgtgaacttaaagtgctccatgagtgc
aatttcccgcatatagttggcttctatggggccttttacagcgatggagagataagcata
tgcatggaatatatggatggcggctcactagatctcatattgaaacgagctggccgcata
cccgaatccatattgggtcgcatcactttggcggtactcaaaggattgagctatttacga
gacaagcatgctattattcatagggatgtgaagccaagtaatatactcgtcaatagcagc
ggagagataaaaatctgtgattttggtgtatcgggtcaattgattgactcgatggccaac
tccttcgtgggcacacgcagttacatgtcgccggaacgattacaaggtactcactattca
gtacagtcggacatttggtcgttgggcctatccttagttgaaatggccatcggcatgtat
ccaataccaccaccagatactgtaaccatggaggccattttcgctgagaactctgatggt
gatgggaatcaaactgtattggagccaaaagtgatggccatatttgaactgcttgattat
attgttaatgaaccgccacctaaattggaacataaaatattttccgatgagtttaaggac
tttgtagacatctgcctcaaaaagcagcccgatgaacgggccgatctcaagacccttctg
agtcatcgctggatacgaaaagcggagctagaggaagtagatatatcaggttgggtctgc
aagacaatggatttgccgccatcgacgccaaagcgcaatacatcgcccaactaa

DBGET integrated database retrieval system