KEGG   Drosophila willistoni: Dwil_GK25179Help
Entry
Dwil_GK25179      CDS       T01067                                 

Definition
GK25179 gene product from transcript GK25179-RA
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dwil_GK25179
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dwil_GK25179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 555 aa AA seqDB search
MESEKILMAAGVTVAAVVGAFVFWGPSGSRLRQRRGQIAGLHNFGRTCFLNTLLQALAAC
PQFIAWLQLYNGASPDRKSLITSMLNTLEVVNGTHATLRGDPHSPGAVLRALNALGWVIP
QEEHDAHELFHILLSSLEEEATRPQPVGCLSDALASADDVDSICIGSATGAATVVGANSG
TNIGQRIGDQPNRPSSAMLSDFLNMEYDEATSLNRLVRSEAHTPDSPASVCEREAPDRLG
SLLDAITPGSAHPFGFPMDLHEPVAASPILGAERLSRPRLPQAQEISEGLNRRVSSSCRS
LERLNRGPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGCNSKSTVRYDKFDSITLNLPPQ
RRTGLSLGHLLSEYITSEDLSDVKCDTCNETTTHTKSVTFAKLPACLCIHIARTVWLPTG
QVCKRQDYVHFPESLSMAPYSFVQPHLNSQAGTPWGSTMSLYSSSFPMNNGIAGASGEGF
GTMFPKNLYRLLAVVVHSGEANSGHFVTYRRGSLRNAHRWFYTSDTVVREVSIDEVLSVP
AYLLFYDRGPQRQMR
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggagagtgagaagatattgatggctgctggtgtgacagtcgctgccgtagttggagca
tttgtcttctggggtccatcaggctctcgtttgcgtcagcggcgtggtcagattgctggt
ctgcacaattttggacgtacttgctttctaaatactctgcttcaggctctggccgcctgc
ccacagtttatagcttggctacaattgtacaatggagcttctccggatcgaaagagctta
ataactagcatgttgaataccctggaggtggtcaatgggacacacgccaccttgcgcggc
gatcctcactccccgggagctgtgcttcgtgccctgaatgccctaggctgggtcatacca
caggaagagcacgatgctcatgagctatttcacattttgctctcatcacttgaagaggag
gccactcggccccaaccggtgggatgcttgtccgatgccctggcatcggctgacgacgtg
gatagcatttgtattggttctgccactggagcagcaacagttgttggtgctaattcaggc
acaaatattggacaacgtattggagatcaaccaaatcgtccttctagtgccatgttatca
gactttcttaacatggaatatgacgaggcgaccagtcttaatcgtttagtccgctccgaa
gctcacactcccgactcgcctgcttcggtctgtgaacgagaagcccccgatcgtttggga
tctctacttgatgctattacacctggttccgcacatccatttggctttcccatggatctc
catgaaccagtggcggcttcccctatattgggtgcggaacgattgtcacgaccacgcttg
cctcaagcccaagaaatcagtgagggtctcaatcgacgtgtctccagttcgtgtcgttcg
cttgaacgtctcaatcgtggtcccggtcgcgtctccatttggtccaatatgatgccaagc
caggtggctcatcctttccagggggccatgggtgcacagattgtctgtaatggctgcaac
tccaagtcgacagtgcgctatgacaagttcgatagcatcaccctgaatttgccgccacag
cggcgcacaggtctgagtctgggacaccttcttagcgaatatattacatcggaggatttg
agcgatgtgaaatgcgatacctgtaatgagaccacaacacacacgaaatctgtgacgttc
gcaaagcttccggcttgtctctgcatacacatagctcgtaccgtttggctacccactggt
caggtgtgcaagcgtcaagattatgttcactttccggagagcctttcaatggctccatat
agctttgttcagccgcatctcaatagccaggctggtacaccctggggatctacaatgtct
ctgtactcatccagttttcccatgaacaatggcattgccggtgctagtggcgaaggcttc
ggcactatgttcccaaagaatctttatcgccttctggcggttgtggtccattctggcgag
gccaatagtggacattttgtaacctatcgtcgtggatccctacggaatgctcatcgttgg
ttctacacatcggacactgttgtgcgcgaggtatccattgatgaggtgctcagtgtgcca
gcctatctgctgttttatgatcggggacctcaacgacaaatgcgctag

DBGET integrated database retrieval system