KEGG   Drosophila willistoni: Dwil_GK25185Help
Entry
Dwil_GK25185      CDS       T01067                                 

Definition
GK25185 gene product from transcript GK25185-RA
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
dwi  Drosophila willistoni
Pathway
Hippo signaling pathway - fly
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway -fly [PATH:dwi04391]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1626 aa AA seqDB search
MQANSSRSTLSAQSSGTPSASTISSSQGKQQVVELSGYVIILVENVEGKIKLYGSPPDRD
NLEVGDEILEVNGLTLDNISRTEVIRHIHDCIKSCTICLRVRKKNDSRLAWDIGNSVQDA
FVIAVEEHARERLQRLAALNRVTPVDITQLSKKLLATHNDVIVHQSSDGTTTTTATSNRS
QQQQQLLNELQQQQQQQQQQLQLQQQNSPTSSISKGRTELLLGDQSLRQESRPRRRSGSS
IVVIDGDDLKPCLPDDYITGQHHHLHHHQQQQQQQQQLQQQLPQQQPQHLQQQQHYRTHS
SDIREIDQEMLTMLSVNQDNGPHREMAVDCPDTFIARNKTPPRYPPPRPPQKHTKLSTNT
NITFTTKSNNDHANKLLIVAYHSSHQHDQQLQQQQQQHEHEHAHQHQQQHSTTLSTTTTT
QLDVATQNLYNQKQQTKLEQIENYENCLQSEQHEQQTLLTIPTATVAATTAATAAATTTT
TIAQQQQQIAQQQTPSNKLLMNNDPNGNNSNNSVTDELICMVDGLYRKGSSSPSSSAFDE
VMSKQQLDTFHAYHQLHHHHHQYQQQSLTTTTTTTTTTSKSPGTGSSSSRSQSALIITNS
SSSNSNSLNSSNSSMHTSNSNSSSNSGSGSGSGSNIPSVASTSASSSSSTTAATTASTTS
TVPDDLSLAPPGYEPNQQQQQQTPATAASASASATSMTNSNSKIPHRELPVDVPDSFIEM
VKTPPRYPPPAHLSSRGSLLSNASSSTAHTTLSSLGVSGSVSGSGSVSGSGYKSSAIVVA
ANVAAGNVVAASSDGNSSSSSKHVAADELNGNAKPVPPPRDHLRVEKDGRLINCAPAPQL
PDRRILGNGSSQQQQQQQQQQIAQIVEPTLEQLDSIKKYQEQLRRRREEEERIAQQNEFL
RNSLRGSRKLKALQDTATATAAVGKAMAQQQQQHQQQQQQQATGVENEAYLPDEEVPQTI
QIDGYGELIAALTRLQSQLSKSGLSTLAGRVSSAHSVLASASVAHVLAARTAVLQRRRPR
VPGPLHFGALGLQKDIVELLTQSNTAAAIELGNLLTSHEMEGLLLAHDRIANHTDATPSP
TATPNSPIQMASTAAAAAAAAAASQGPAVKRNLPVAVAPPVVPPLPVSQRGAMPLPLPAR
NDSPPPMSACFGTLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGGAAEKSGL
LHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPPGGGNLVGQGSIGSM
SVGGGTGLGGGHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWW
QAYREGEEDQTLAGLIPSQSFQHQRETMKLAIAEEAGLARSRGKEGTSGKGATLLCARKG
RKKKKKASSEAGYPLYATTAPDETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHE
LRQRLMADSERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAY
YGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEP
FKEEELKDIIATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQWVH
NNRDES
NT seq 4881 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaatagcagtcgatccacattaagcgcacaatcctcgggcacaccgtcagcc
tcaacgatatcctcatcccagggcaagcaacaagttgtcgagctatccggctatgtcatc
attctcgttgagaatgtggagggtaaaattaaattatatggctcaccgcccgatcgcgat
aatctggaagtgggcgatgagatactcgaggttaatggattgactctggacaatatatcg
cgcacggaagttatacggcatatacatgattgcattaaatcctgcacaatttgtttgcgt
gtacgcaaaaagaatgattccagattggcctgggatattggcaattcggtgcaggacgcg
tttgtcattgccgtcgaggagcatgcccgtgagcgtttgcagcgattggccgccttgaat
cgtgtcacgcccgtggatataacgcaactctcaaaaaagttactagctacgcataatgat
gtcatagtgcatcagtccagtgatggaacaacaacaacaacagcaaccagcaatcggagt
caacaacaacaacaattgctgaatgagctgcaacagcaacagcaacaacaacaacagcaa
ttacaattgcaacaacaaaacagtcccacaagtagcatatcaaaaggaagaactgaactt
ttattgggcgatcaaagtcttcgccaggaatcaaggccacgccggcgttccggttcgagc
attgtagtcattgatggtgatgatttgaagccatgtctgccggatgattatataactggt
cagcatcatcatctgcatcatcatcaacagcagcagcagcagcagcagcaactgcagcaa
cagctgccgcaacagcagcctcaacatttgcaacagcaacaacattatcgaacacactcg
agtgatattagggagatcgatcaggaaatgctgaccatgctgtcggtgaatcaagataac
ggtccacatcgtgagatggccgtcgactgtccagatacgtttatagcacgtaataagacg
ccacccagatatccgccaccccgtccaccacagaaacatacaaaattgagcaccaacaca
aatatcacattcacaactaaatctaataatgatcatgctaacaaattgttaattgttgca
tatcattcttcacatcaacatgatcaacaactacaacaacaacaacaacaacatgaacat
gaacatgctcatcaacatcaacaacaacactcaacaacattgtcaacaacaacaacaaca
caactcgatgtggccacacaaaatttgtataatcaaaaacaacaaactaaattggaacaa
attgaaaactatgaaaattgtctacaatcggaacaacacgaacagcaaacattattaacc
ataccaacagcaacagtagcagcaacaacagcagcaacagcagcagcaacaacaacaaca
acaattgctcaacaacaacaacaaatagcccaacaacaaacgcccagcaataaattgtta
atgaacaatgatccaaatggcaacaatagcaataatagtgtcactgatgaattgatctgc
atggtagatggtctatatcgtaaaggttccagctcaccatcatcgagtgctttcgatgag
gtgatgagcaaacaacaattggatacatttcatgcctatcatcaattgcatcatcatcat
catcaatatcaacaacaatcattgacgacgacgacaacaacaacaacaacaacaagtaaa
agccctggcactggcagcagcagcagccgcagtcagtcagcattaattataaccaacagc
agcagcagtaacagcaactcattgaacagcagcaatagttcaatgcatacaagtaatagt
aatagcagtagcaacagtggcagcggcagcggcagcggcagcaatatacccagtgtggca
tcaacatcagcatcatcatcgtcatcgacaacagcagcaacaacagcgagcaccacatca
acagtgccagatgatttaagtttagcaccaccaggctatgagcctaatcaacagcagcag
cagcaaacaccagcaacagcagcatcagcatcagcatcagcaacttcaatgacaaacagc
aacagcaagataccacatcgtgaattgccggttgatgtgccggatagttttattgagatg
gttaaaacgccgccacgttatccaccgccagcacatctttcatcacgtggctcgttgcta
tcgaatgccagctcctcgacggcacacacaacgttgtcatcgctgggcgtgtctggatct
gtttcggggtctggttctgtttcaggttctggctataagtcgtcagcaattgttgttgct
gcgaatgttgctgctggtaatgttgttgctgcgagcagcgatggcaacagcagcagtagc
agcaagcacgtagctgcagatgagcttaatggtaatgcaaaacccgtgccacctccacgc
gatcatttgcgtgtggagaaggatggacgccttatcaattgtgcacccgcccctcaattg
cccgatcgtcgcattttgggcaatggcagcagtcaacaacaacaacaacagcagcaacaa
caaattgcccaaattgttgaacctacattggaacaattggatagcataaagaaatatcag
gagcaactgcgtcggcgacgcgaagaggaggaacgcattgcccagcagaatgagttcctc
cggaatagtttgcgtggatcgcgtaagttgaaggcactgcaagacacggccacggccaca
gcagccgttggcaaggccatggcccagcagcagcagcagcaccaacaacagcagcagcaa
caagcgaccggtgtggagaatgaggcatatttgcccgatgaggaagtgccacagaccatt
cagatcgatggttatggcgaactgattgccgccttaacacgcctccagagtcagttaagc
aagagcggcctgagcaccctggccggacgtgtttccagtgcccacagtgtcctggccagt
gccagtgtggcgcatgttctggccgctcgcaccgctgtgctgcagcgtcgacgaccccgt
gtcccgggacccttgcattttggcgccttgggactccaaaaggacattgttgagctgctg
acacaatcgaatacggcggcggccatcgaattgggcaacctgttgaccagtcacgaaatg
gagggcctattgttggctcatgatcgcattgccaatcacacggatgccactccctcaccg
acagccacgccaaacagtccgattcaaatggccagcacggcagcagcggcggcggcggcg
gcggcggcatcgcagggaccggcggttaagcggaatcttccagtagcggtggctccgccg
gtggtgccgccattgccagtgtctcagcgtggtgccatgccgttgccgttgccagcgcgt
aacgattcgccgccaccgatgagcgcctgctttggaacactgaacgatcagaacgataac
attcgaattatacagatcgagaagtcaacggagccgctgggcgccactgtgcgcaatgag
ggcgaagctgtggtcattggacgcattgtgcgcggcggggcggctgagaagtcgggtctc
ttgcacgagggcgatgaaattttggaggtgaatggtcaggagttgcgcggcaagacggtg
aacgaggtgtgcgccctattgggcgccatgcagggcacccttacctttctcattgtgccg
gcgggtagtccgcccccgggaggcggtaacttggtcggccagggctccattggctccatg
tcagtgggtggaggcacgggattgggtggtggacaccgcgatacagccgtcttgcatgtg
cgagcccacttcgattacgatcccgaggatgatctgtatataccgtgccgagagcttggc
attagtttccagaagggcgatgtgctgcatgtgatctcgcgcgaggatcccaattggtgg
caggcttatcgcgagggcgaggaggatcagacactggccggcctcatacctagtcaatcg
tttcagcatcagcgtgagaccatgaagctggccattgccgaggaggcgggcctggcccgt
tcacgtggcaaggagggaaccagtggcaagggggccactttgctttgtgcacgcaagggt
cgcaagaagaagaagaaggccagctcagaagcgggttatcctttgtatgcgacaacggcg
ccagatgaaaccgatcccgaagagatactcacctatgaagaggtggccctctattaccca
cgtgcaacccacaagcgtcccattgtactcattggaccaccaaatatcggcaggcatgag
ctgcgccaacgcttgatggcggactctgaacgcttctcggcggcagtgccacatacatcc
cgcgctcgacgcgaaggcgaagtgccgggcgttgattatcatttcattacgcggcaggca
tttgaagcggatatcctggcccgtcgatttgtggagcacggcgaatacgagaaggcctac
tacggcacatcactggaggccatacgcacggttgttgccagcggcaagatctgtgtacta
aatctgcatccgcagagcttaaaactattgcgagcctcggacctcaagccctatgtggtc
cttgtggcacctcccagtcttgataaattgcgtcagaagaaattgcgcaatggcgagcca
ttcaaagaggaagagcttaaagacattattgccactgcacgtgacatggaagcacgttgg
ggtcatctattcgatatgattatcatcaacaacgatacggaacgggcctatcatcagcta
ttggcggagattaattcgctggaacgggaaccgcaatgggtaccagcccaatgggtgcac
aacaatcgcgacgagtcataa

DBGET integrated database retrieval system