KEGG   Drosophila willistoni: Dwil_GK25185Help
Entry
Dwil_GK25185      CDS       T01067                                 

Definition
(RefSeq) GK25185 gene product from transcript GK25185-RB
  KO
K06091  
MAGUK p55 subfamily member 5
Organism
dwi  Drosophila willistoni
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dwil_GK25185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1169 aa AA seqDB search
MQANSSRSTLSAQSSGTPSASTISSSQGKQQVVELSGYVIILVENVEGKIKLYGSPPDRD
NLEVGDEILEVNGLTLDNISRTEVIRHIHDCIKSCTICLRVRKKNDSRLAWDIGNSVQDA
FVIAVEEHARERLQRLAALNRVTPVDITQLSKKLLATHNDVIVHQSSDGTTTTTATSNRS
QQQQQLLNELQQQQQQQQQQLQLQQQNSPTSSISKGRTELLLGDQSLRQESRPRRRSGSS
IVVIDGDDLKPCLPDDYITGQHHHLHHHQQQQQQQQQLQQQLPQQQPQHLQQQQHYRTHS
SDIREIDQEMLTMLSVNQDNGPHREMAVDCPDTFIARNKTPPRYPPPRPPQLNGNAKPVP
PPRDHLRVEKDGRLINCAPAPQLPDRRILGNGSSQQQQQQQQQQIAQIVEPTLEQLDSIK
KYQEQLRRRREEEERIAQQNEFLRNSLRGSRKLKALQDTATATAAVGKAMAQQQQQHQQQ
QQQQATGVENEAYLPDEEVPQTIQIDGYGELIAALTRLQSQLSKSGLSTLAGRVSSAHSV
LASASVAHVLAARTAVLQRRRPRVPGPLHFGALGLQKDIVELLTQSNTAAAIELGNLLTS
HEMEGLLLAHDRIANHTDATPSPTATPNSPIQMASTAAAAAAAAAASQGPAVKRNLPVAV
APPVVPPLPVSQRGAMPLPLPARNDSPPPMSACFGTLNDQNDNIRIIQIEKSTEPLGATV
RNEGEAVVIGRIVRGGAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFL
IVPAGSPPPGGGNLVGQGSIGSMSVGGGTGLGGGHRDTAVLHVRAHFDYDPEDDLYIPCR
ELGISFQKGDVLHVISREDPNWWQAYREGEEDQTLAGLIPSQSFQHQRETMKLAIAEEAG
LARSRGKEGTSGKGATLLCARKGRKKKKKASSEAGYPLYATTAPDETDPEEILTYEEVAL
YYPRATHKRPIVLIGPPNIGRHELRQRLMADSERFSAAVPHTSRARREGEVPGVDYHFIT
RQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKP
YVVLVAPPSLDKLRQKKLRNGEPFKEEELKDIIATARDMEARWGHLFDMIIINNDTERAY
HQLLAEINSLEREPQWVPAQWVHNNRDES
NT seq 3510 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaatagcagtcgatccacattaagcgcacaatcctcgggcacaccgtcagcc
tcaacgatatcctcatcccagggcaagcaacaagttgtcgagctatccggctatgtcatc
attctcgttgagaatgtggagggtaaaattaaattatatggctcaccgcccgatcgcgat
aatctggaagtgggcgatgagatactcgaggttaatggattgactctggacaatatatcg
cgcacggaagttatacggcatatacatgattgcattaaatcctgcacaatttgtttgcgt
gtacgcaaaaagaatgattccagattggcctgggatattggcaattcggtgcaggacgcg
tttgtcattgccgtcgaggagcatgcccgtgagcgtttgcagcgattggccgccttgaat
cgtgtcacgcccgtggatataacgcaactctcaaaaaagttactagctacgcataatgat
gtcatagtgcatcagtccagtgatggaacaacaacaacaacagcaaccagcaatcggagt
caacaacaacaacaattgctgaatgagctgcaacagcaacagcaacaacaacaacagcaa
ttacaattgcaacaacaaaacagtcccacaagtagcatatcaaaaggaagaactgaactt
ttattgggcgatcaaagtcttcgccaggaatcaaggccacgccggcgttccggttcgagc
attgtagtcattgatggtgatgatttgaagccatgtctgccggatgattatataactggt
cagcatcatcatctgcatcatcatcaacagcagcagcagcagcagcagcaactgcagcaa
cagctgccgcaacagcagcctcaacatttgcaacagcaacaacattatcgaacacactcg
agtgatattagggagatcgatcaggaaatgctgaccatgctgtcggtgaatcaagataac
ggtccacatcgtgagatggccgtcgactgtccagatacgtttatagcacgtaataagacg
ccacccagatatccgccaccccgtccaccacagcttaatggtaatgcaaaacccgtgcca
cctccacgcgatcatttgcgtgtggagaaggatggacgccttatcaattgtgcacccgcc
cctcaattgcccgatcgtcgcattttgggcaatggcagcagtcaacaacaacaacaacag
cagcaacaacaaattgcccaaattgttgaacctacattggaacaattggatagcataaag
aaatatcaggagcaactgcgtcggcgacgcgaagaggaggaacgcattgcccagcagaat
gagttcctccggaatagtttgcgtggatcgcgtaagttgaaggcactgcaagacacggcc
acggccacagcagccgttggcaaggccatggcccagcagcagcagcagcaccaacaacag
cagcagcaacaagcgaccggtgtggagaatgaggcatatttgcccgatgaggaagtgcca
cagaccattcagatcgatggttatggcgaactgattgccgccttaacacgcctccagagt
cagttaagcaagagcggcctgagcaccctggccggacgtgtttccagtgcccacagtgtc
ctggccagtgccagtgtggcgcatgttctggccgctcgcaccgctgtgctgcagcgtcga
cgaccccgtgtcccgggacccttgcattttggcgccttgggactccaaaaggacattgtt
gagctgctgacacaatcgaatacggcggcggccatcgaattgggcaacctgttgaccagt
cacgaaatggagggcctattgttggctcatgatcgcattgccaatcacacggatgccact
ccctcaccgacagccacgccaaacagtccgattcaaatggccagcacggcagcagcggcg
gcggcggcggcggcggcatcgcagggaccggcggttaagcggaatcttccagtagcggtg
gctccgccggtggtgccgccattgccagtgtctcagcgtggtgccatgccgttgccgttg
ccagcgcgtaacgattcgccgccaccgatgagcgcctgctttggaacactgaacgatcag
aacgataacattcgaattatacagatcgagaagtcaacggagccgctgggcgccactgtg
cgcaatgagggcgaagctgtggtcattggacgcattgtgcgcggcggggcggctgagaag
tcgggtctcttgcacgagggcgatgaaattttggaggtgaatggtcaggagttgcgcggc
aagacggtgaacgaggtgtgcgccctattgggcgccatgcagggcacccttacctttctc
attgtgccggcgggtagtccgcccccgggaggcggtaacttggtcggccagggctccatt
ggctccatgtcagtgggtggaggcacgggattgggtggtggacaccgcgatacagccgtc
ttgcatgtgcgagcccacttcgattacgatcccgaggatgatctgtatataccgtgccga
gagcttggcattagtttccagaagggcgatgtgctgcatgtgatctcgcgcgaggatccc
aattggtggcaggcttatcgcgagggcgaggaggatcagacactggccggcctcatacct
agtcaatcgtttcagcatcagcgtgagaccatgaagctggccattgccgaggaggcgggc
ctggcccgttcacgtggcaaggagggaaccagtggcaagggggccactttgctttgtgca
cgcaagggtcgcaagaagaagaagaaggccagctcagaagcgggttatcctttgtatgcg
acaacggcgccagatgaaaccgatcccgaagagatactcacctatgaagaggtggccctc
tattacccacgtgcaacccacaagcgtcccattgtactcattggaccaccaaatatcggc
aggcatgagctgcgccaacgcttgatggcggactctgaacgcttctcggcggcagtgcca
catacatcccgcgctcgacgcgaaggcgaagtgccgggcgttgattatcatttcattacg
cggcaggcatttgaagcggatatcctggcccgtcgatttgtggagcacggcgaatacgag
aaggcctactacggcacatcactggaggccatacgcacggttgttgccagcggcaagatc
tgtgtactaaatctgcatccgcagagcttaaaactattgcgagcctcggacctcaagccc
tatgtggtccttgtggcacctcccagtcttgataaattgcgtcagaagaaattgcgcaat
ggcgagccattcaaagaggaagagcttaaagacattattgccactgcacgtgacatggaa
gcacgttggggtcatctattcgatatgattatcatcaacaacgatacggaacgggcctat
catcagctattggcggagattaattcgctggaacgggaaccgcaatgggtaccagcccaa
tgggtgcacaacaatcgcgacgagtcataa

DBGET integrated database retrieval system