KEGG   Drosophila willistoni: Dwil_GK25189Help
Entry
Dwil_GK25189      CDS       T01067                                 

Definition
GK25189 gene product from transcript GK25189-RA
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dwi  Drosophila willistoni
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dwi00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 316 aa AA seqDB search
MARLVESNFVPIAVGVVAVVAGALIVHYFLNKKSTKPRREPNRTARLRTLVDPNDKYQLP
LIEKEILSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELVIRPYTPISSDEDVGYV
DLVVKVYFKDSHPKFPAGGKMTQFLEQMEIGHKISFRGPSGRLQYLGNGTFSIKKLRKDP
PKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDEL
AQKHPDQFKVWYTVDKAAEGWAYSVGFINDEMIGAHLLPASDDTIVLLCGPPPMINFACN
PALDKLGYHPDTRFAY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtctcgttgagagcaatttcgttcccattgctgtgggcgtggtggccgtggta
gccggtgccctgattgtgcattatttcctgaacaaaaaatcaacgaaacccagacgggaa
cccaatcgtactgcccgcctacgtactctagtcgatcccaatgataaatatcaattgcca
ttgattgaaaaggagatactcagccatgacacacgacgttttcgttttggactgccatct
aagcagcatgtcctgggattgcctgtcggccagcatatccatttgatagccaccattgat
aatgagctagttatacgtccatataccccaatctcgtccgacgaagatgtcggctatgtg
gacttggtggttaaggtctattttaaggattcgcatcccaaattcccagctggcggcaag
atgacacagttcttggagcaaatggagatcggacataagatctcattccgtggtccatcc
ggacgtctgcagtatctgggcaacggcacgttctccataaagaaattgcgcaaggatccg
cccaagcatgtgacagccaaacgtgtgaatatgattgccggtggtacgggtatcactccc
atgttgcagttggcccgtgaggttcttaagcgcagtgacaaggataagactgaattggca
ttgctttttgccaatcagagcgaaaaagatattctcctgcgtgccgaattggatgaattg
gcacagaagcatcctgatcagtttaaggtttggtacaccgttgataaggcagccgaaggc
tgggcttatagcgttggctttatcaatgacgaaatgattggcgcccatttacttccggcc
agcgatgatacgatcgttctgctttgcggaccaccacccatgatcaactttgcctgcaat
ccggctctggataaacttggctatcatccggacacacgattcgcatactaa

DBGET integrated database retrieval system