KEGG   Drosophila willistoni: Dwil_GK25249Help
Entry
Dwil_GK25249      CDS       T01067                                 

Definition
(RefSeq) GK25249 gene product from transcript GK25249-RB
  KO
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dwi  Drosophila willistoni
Pathway
Protein processing in endoplasmic reticulum
Apoptosis - fly
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dwil_GK25249
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dwil_GK25249
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dwil_GK25249
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dwil_GK25249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1146 aa AA seqDB search
MSTTIEFETIGNRLQSLEAALQAQNESHEQIVLTNARGARIPPRHPCPCQCHKLELLGWL
PVHHYHHQHQHTGALISAKPTTAAGSIVPPSVKNVNTCIASRPAPAIPVPNTNASAASSF
TGLIPGNFVPPSRSLRPTPNLPISEMGSYQKRRMMLPLPTQAHPSETETDKKLKVIMNQT
GKLNIDGRQYPTDINDLQHLGDLGNGTSGNVVKMRHLSSKTIIAVKQMRRTGNAEENKRI
LMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPECILGKVT
VATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAY
MAPERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPRG
EGFNFSEEFHVFVNKCLTKNHQDRPKYPELLAQKFITFYETEDVDVPYWFQNVVDTAGRR
LRSNGGDHSTMMRTTGTGNGTGLESATGATHKYGRGGAITSPTTNPNPQKTIKPTQIPSY
QQQQQSSSSSSGNSPLSPSGGSGSSDIPKLYRKSPFMQRKLSNNTVGTHYSSKYNDGSPK
KESMFSSIGQSILRNLTTSPFSQKKHNNPLPASRQMETNLTTTTSPTMTMPTWRLPADND
SCDSSSKNGLASSPTAERIEMLPQSPPTATISPGSQQSQQPQQQRLQPGNQSPIVLQRFY
HQQNQLREKEAAERYQRQPAAGAGSVAPPTQSQPPPPPLVIGSTNPFHSNYVAPASSIHS
NSSQSSTQSTCSQIAITTSPQPANQPPAAAAGHFGVGHMTEQLQYQPLPTTTTAAATTTT
NAASTTSELCNSPAAADLHQIDLLIGSGSGSGSGSLMGSKLSKLYARRQLLGQSCSTSSG
ATSNSSSSSLDGKDHHMLYSHNHGHTNHDAGWFNTLAGAMKRQFATYVKTQLNSTVTSPV
AEQQQQQQQPPPQTYRNIINGNNGSGSGSGSGSGSGSKSYYYRTLSAASSSSNTSQSTSP
TTEPIAGSSGGFLRRYINNTSGTGSISTPPSPHILAGLDRRHRSPDPPPRYNRGQSPLLL
RKNLLELSGQTQGSPLMQRRYVSASPPLLPPPRRGSESVPGSPQHFRTRIHYTPEPQRRI
YRTIDQ
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaacaattgaattcgagacaattggaaatcgtctgcaatccctggaggctgct
ctccaggctcaaaacgaatcccatgaacaaatcgttttaaccaatgcccgaggagcgcgt
atacccccccgccacccatgcccttgccaatgtcacaaactggagctgctgggttggcta
ccggtccatcattatcatcatcagcatcaacatacaggagcactgatatcggcaaaacca
acaacagctgctggctcaattgtacctccctccgtcaagaatgtcaacacctgcatagca
tctaggccagcgccagcaattcctgttcctaacaccaatgcctccgccgcttccagtttt
acaggcctcatccctggtaactttgtcccgccttcaaggagtttgcgcccaacgccaaat
ttgcccatatccgagatgggttcctatcaaaagcgtcgcatgatgctgccactgcccaca
caggcgcatccgtccgaaacggaaacggacaaaaaactgaaagtgataatgaaccaaacg
ggcaaactgaatatcgatggacgtcagtatcccacggatattaatgatctgcaacatttg
ggtgatttgggcaatggaacgagcggcaatgtggtaaaaatgaggcatttgtctagtaaa
acaattattgcggtcaaacaaatgcgtcgcaccgggaatgcggaggagaacaaacgcatt
ctaatggatttggatgtggtactaaagtcgcacgattgtaaatatattgtaaaatgtctg
ggttgctttgtacgcgatccagatgtatggatatgtatggaattgatgtccatgtgtttt
gacaaattgctcaagttgtccaagaagccagtgcccgagtgtatactgggcaaggtgaca
gtggcgacggtgaatgccctctcatatctaaaggataagcatggtgttatccatcgcgat
gtgaaaccatctaacatactgatcgatgaacgtggtaatataaagctttgcgattttggt
attagcggtcgtctagtggattccaaagccaatacacgatcggccggctgtgcagcctat
atggcgcctgaacgtattgatccaaagaagcccaaatatgatatacgcgccgatgtatgg
tcattaggcataaccctggttgagttggccacagcgcgctcaccatatgaaggctgtaat
actgattttgaggtgctgaccaaagtgctagattcagagccaccatgtttgccgcgtggt
gagggcttcaatttcagtgaggagtttcatgtttttgtcaataagtgcctcacaaagaat
catcaggatcgtcccaaatatccggaactgctggcccagaaatttataacgttctatgaa
acggaagatgttgatgtcccttattggtttcaaaatgttgtagacactgccggacggcgt
ctgcgttcaaatggcggtgatcattcaacaatgatgagaacaactggaactggaaatgga
actggtctagaatcagcaacaggagccacacacaaatatgggagaggaggagcaatcaca
agtcccacaacaaatccaaatccacaaaagacaataaaacccacgcaaataccaagctat
cagcagcaacagcaaagcagcagtagtagtagcggaaatagccccttatcaccatcaggt
ggatctggatctagtgatataccaaaactttatcgcaaatctccatttatgcagcgtaaa
ctgagcaataatacggttggaacacattatagtagtaaatataacgacggtagccccaaa
aaggagtccatgtttagcagcataggccaatcgattttacgtaatttgaccacatcgccc
tttagccaaaagaaacataataatccactgccagcaagtcgacaaatggagacaaattta
accacaactacaagcccgacaatgacgatgccaacatggcgtctgccagccgataacgat
agctgtgatagtagtagtaaaaacggtttagcttcttcacccacggcagagcgcatagag
atgctgccgcaatcgccaccaacagcaacgatcagtcccggcagtcaacagtcacagcaa
ccacagcagcagcgtctccagccgggcaatcagagtcccatagttctgcaacgtttctac
catcaacagaatcaactgcgcgaaaaggaggctgctgaaaggtatcaacgtcagccagca
gcaggagcaggatcagtagcaccaccaacacaatcacaaccaccaccaccaccattagtg
atcggcagtacaaatccatttcatagcaattatgtggctcccgcatcttctatacactcc
aattctagtcaatcatcgacacaatcgacttgctctcaaatagcaataacaacttcaccg
caacctgctaatcaaccaccagctgcagcagctggacattttggtgttggtcatatgacc
gaacagttgcaatatcaacctttacccacaacaacaacagcagcagcaaccacaacaaca
aacgctgcatcaacaacatcggagctatgtaattcaccagcagcagctgatctacatcaa
attgatttgttaattggttccggttctggttctggttctggatctctaatgggcagcaaa
ttgagcaaattgtatgcacgacggcagttgctgggtcagagctgctctaccagcagtgga
gcgacaagcaatagcagcagcagtagccttgatggcaaggatcatcatatgctatatagc
cataaccatggccataccaatcatgatgcggggtggttcaacacattggcaggtgccatg
aagcgacagtttgccacctatgttaaaacccaattgaattccacagtcacatcgccggtg
gcagagcagcagcagcagcagcaacaaccgccgcctcaaacctataggaacattattaat
gggaataatggcagtggcagtggcagtggcagtggcagtggcagtggcagtaaatcctat
tactatcgtactctatccgcagccagcagtagtagtaataccagccaaagtacatcaccc
acaacagaaccaatagccggcagtagcggtggattccttcgtcggtatataaacaataca
tcgggtacgggtagcattagcacaccacccagtcctcatatattagccggtctggatcgg
agacatcgaagtccagatccccctccacgctataatcgtggacaatcaccgcttttgttg
cgtaaaaatctactcgaactaagtggtcagacacagggttcgccgcttatgcaaagacgt
tatgtgtctgcttcgccaccattgctaccgcctccgcgtcgtggttcggagagtgtgcca
ggatcaccgcaacattttcgtactcgcatccattatacacctgagccacagcgacgcata
tatcgcaccatagatcaatga

DBGET integrated database retrieval system