KEGG   Drosophila willistoni: Dwil_GK25278Help
Entry
Dwil_GK25278      CDS       T01067                                 

Definition
GK25278 gene product from transcript GK25278-RA
Orthology
K04646  
clathrin heavy chain
Organism
dwi  Drosophila willistoni
Pathway
Lysosome
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dwi04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dwi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1681 aa AA seqDB search
MTQPLPIRFQEHLQLTNVGINANSFSFSTLTMESDKFICVREKVNDTAQVVIIDMNDSAN
PTRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLA
LVTETSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNASQQWLLLVGISALPSRVAGA
MQLYSVERKVSQAIEGHAASFATFKIEGNKEPTTLFCFAVRTATGGKLHIIEVGTPPNGN
QPFPKKAVDVFFPPEAQNDFPVAMQVSAKYDTIYLITKYGYIHLYDMETATCIYMNRISA
DTIFVTAPHEASGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLAGA
EDLFVRKFNKLFTAGQYAEAAKVAALAPKGILRTPQTIQRFQQVQTPAGSTTPPLLQYFG
ILLDQGKLNKFESLELCRPVLLQGKKQLCEKWLKEEKLECSEELGDLVKTSDLTLALSIY
LRANVPNKVIQCFAETGQFQKIVLYAKKVNYTPDYIFLLRSVMRSNPEQGAGFASMLVAE
EEPLADINQIVDIFMEHSMVQQCTAFLLDALKHNRPAEGALQTRLLEMNLMSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHMLNAEWLVSFFGTLS
VEDSLECLKAMLTANLRQNLQICVQIATKYHEQLTTKALIDLFESFKSYDGLFYFLSSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERFLKENQY
YDSRVVGRYCEKRDPHLACVAYERGQCDRELIAVCNENSLFKSEARYLVGRRDAELWAEV
LSEANPYKRQLIDQVVQTALSETQDPEDISVTVKAFMTADLPNELIELLEKIILDSSVFS
DHRNLQNLLILTAIKADRTRVMDYINRLDNYDAPDIANIAISNQLYEEAFAIFKKFDVNT
SAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYMD
VVDVASRVESWDDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFISGPNHADIQ
KIGDRCFSDGMYDAAKLLYNNVSNFARLXXXXXXXXXAVDSARKANSTRTWKEVCFACVD
AEEFRLAQMCGLHIVVHADELEDLINYYQNRGYFEELIALLESALGLERAHMGMFTELAI
LYSKFKPSKMREHLELFWSRVNIPKVLRAAESAHLWSELVFLYDKYEEYDNAVLAMMAHP
TEAWREGHFKDIITKVANIELYYKAIEFYLDFKPLLLNDMLLVLAPRMDHTRAVSYFSKT
GYLPLVKPYLRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDTIALAQKLEKH
ELTEFRRIAAYLYKGNNRWKQSVELCKKDKLYKDAMEYAAESGKQEIAEELLGWFLERNA
HDCFAACLYQCYDLLRPDVILELAWKHKIMDFAMPYLIQVLREYTSKVDKLELNEAQREK
EDDTTEHKTIIKMEPQLMITAGPAMGIPQQYAQNYPPGAAAAAAAAAAATAAGRNMGYPY
L
NT seq 5046 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccgttacccatacgctttcaagagcatttacagctcacaaatgtcggcatc
aatgcaaactcgttctccttcagcacgcttacaatggaatcggataagttcatttgtgtg
cgtgaaaaggtcaatgataccgcccaagtggtcattattgatatgaacgattcggcgaat
ccaacacgacgtcccatatcagcggattcagcgattatgaatccggccagcaaggtgatt
gcgctcaaagcgcaaaagacattgcaaattttcaatatcgaaatgaaatcgaaaatgaag
gcacatacaatgaacgaggatgttgtattctggaaatggatatcattgaatactttggcc
ctggtaacggagacaagtgtattccattggtccatggagggcgattcgatgccacagaaa
atgtttgatagacattcctcgctcaatggttgccagataatcaattatcgttgcaatgcc
tcacagcaatggttactcttggttggtatctctgccctgcccagtcgtgtggccggtgcc
atgcaattatattccgtggagcgtaaagtatctcaggcaattgagggacatgcggccagt
tttgccaccttcaagattgagggtaacaaggagccaacaacattgttttgttttgctgtg
cgcacggcgacgggcggaaaattgcatatcattgaggttgggacaccgcccaatggcaat
caaccgttccccaaaaaggctgtcgatgtattctttccgcccgaggcccaaaacgatttc
ccggtggccatgcaggtctccgccaagtatgataccatctatttgatcaccaaatatggt
tatattcatctctatgacatggagacggccacgtgcatttacatgaatcgcatatcggcg
gatacgatttttgtgacagcaccgcacgaggccagcggcggtattattggtgttaatcgc
aagggccaggtattatccgtgactgttgatgaggagcaaatcataccgtacattaatacg
gtattgcagaatccggatttggcattacgaatggcagtgcgcaacaatttggccggtgcc
gaagatttgtttgtacgcaaatttaataaactcttcaccgccggtcaatatgccgaagcc
gccaaagtggccgccctagcgcccaagggtatattgcgtacaccgcagacaatacaacgt
ttccagcaggtgcaaactccggctggttcgacaaccccgccgctcttgcaatactttggt
atactactcgatcagggtaaattgaataagtttgagtcgttggaactctgccgtccggtt
ctgttgcagggcaagaagcagctatgcgagaaatggcttaaagaggagaaactcgaatgt
agcgaagaattgggtgatttggtcaagacatcggatctaacactcgctctgtccatctat
ctgagagccaatgtacccaataaggtaatacaatgctttgccgaaacgggacaattccaa
aagattgtgctctatgccaaaaaggttaactacacaccggactatatattcctgttgcgt
tcggtaatgcgtagcaatccggaacagggtgctggatttgcatccatgttggttgccgaa
gaggaaccattggccgatatcaatcagattgtcgatatctttatggagcattcgatggtg
cagcagtgtacagcatttctattggatgccctcaagcataatcgtccagcggagggtgct
ctacagacacgtttgctcgaaatgaatctaatgtcggcgccacaagtggccgatgccatt
ttgggtaatgccatgttcacccactatgatcgtgcgcatattgcccaattgtgcgagaaa
gctggcctcttgcaacgtgccctggaacactataccgatctgtatgacataaagcgagct
gttgtccacacccatatgctgaatgccgaatggctggtgagtttctttggcaccctttcg
gtggaggattcattggaatgccttaaggccatgttaacggcaaatttgcgtcaaaattta
caaatctgtgtgcaaatagccaccaaatatcatgaacaattgaccaccaaggcgctgatt
gatctctttgaaagcttcaagagctacgatggcctattctatttcttgagcagcattgtc
aatttctcgcaagatccggaagtgcatttcaagtatatacaggcggcatgtaaaaccaat
cagatcaaggaagtggaacgcatttgccgcgaatcgaactgctataatccggagagagtt
aagaatttcttgaaggaggccaaactaaccgatcaattgccattgatcattgtctgcgat
cgtttcgattttgtacacgatcttgtcctctatctgtatcgtaacaatctacagaaatat
attgagatctatgtgcagaaggtgaatccatcgcgtctgcccgttgtcgttggtggcctc
ctggatgtcgattgcagcgaggatatcattaagaatctaattttggtggtcaagggacaa
ttctcgaccgatgaactggtcgaagaggttgagaaacgtaatcgtttgaaattattgcta
ccttggctagagtcccgtgtccatgagggttgcgttgagccggccacccacaatgccttg
gccaaaatttacattgattcgaacaataatccggaacgtttcctcaaagagaatcaatac
tatgacagccgtgttgtcggacgttactgtgagaagcgtgatccgcatttggcttgcgtg
gcctatgagcggggacaatgcgatcgcgaattgattgccgtttgtaatgagaattctcta
ttcaagagcgaggcacgctatttggttggacgtcgtgatgctgaactctgggcggaggta
ctatccgaggctaatccctataagcgacaacttatcgatcaggttgtgcagacagctctc
tccgagactcaagatcctgaggatatatcggtgactgttaaggcattcatgacagccgat
ttgcccaacgagttgattgaattgcttgagaaaatcattttggattcatcggtatttagc
gatcatcgcaatttacaaaatctattgatactcaccgccatcaaggcggatcgtacacga
gttatggactatatcaatcgtttggataactacgatgctcccgatatagcaaacattgcg
attagcaatcaattgtacgaggaggcattcgccatattcaagaaattcgatgtgaatacc
tcggcaattcaggtactgatcgatcaagtgaacaatttggagcgagccaatgaatttgct
gaacgttgcaatgagccggcagtttggtcacaattggccaaagcccaattgcaacagggc
ctggtgaaggaggccatcgattcgtatattaaggccgatgatccaagcgcctatatggat
gtggtcgatgtggccagtcgtgtcgaatcgtgggatgatctggtgcgttatctgcaaatg
gcccgcaaaaaggcacgcgaatcgtatattgaaagtgaattgatctatgcctatgcacgc
accggacgtttggccgatcttgaggagttcatctcgggaccaaatcacgcggatatacaa
aagatcggtgaccgttgctttagcgatggcatgtacgatgccgccaaattgttgtacaat
aatgttagcaatttcgcccgcttgnnnnnnnnnnnnnnnnnnnnnnnnngtgccgtggat
tcggcccgcaaagccaattcgacacgcacctggaaggaggtttgctttgcttgcgtcgat
gccgaggagttccgtttggctcagatgtgcggtctgcatattgttgtgcatgccgatgag
ctggaagatttgatcaactactatcagaatcgtggctattttgaggaattaattgcactg
cttgaatccgctctgggcttggaacgtgcccatatgggaatgtttaccgaattggccatt
ttgtattccaaattcaagccatcgaaaatgcgtgaacacttggaattgttttggtcacgt
gtgaatataccaaaagttttgcgtgccgccgaatcggcacatttgtggtccgaattggta
ttcctttatgataaatatgaggaatatgataatgctgtgcttgcgatgatggcccatccc
acagaggcatggcgagagggacatttcaaggatattatcaccaaggtggccaatattgag
ctctattataaggcaattgaattctatttggatttcaagccattgctattgaacgatatg
ctcttggtattggcaccgcgcatggatcatacccgagctgttagttatttctcgaaaacg
ggctacttgccattggttaaaccctatttgagatcagtgcaatcgttgaacaataaggcg
atcaatgaggcactcaatggcctgcttatcgatgaggaggattaccaaggtttacgcaat
tcgattgatggttttgataatttcgatacgattgctttggcccagaagctggagaagcac
gagctaaccgaattccgtcgcattgcagcctatttatacaagggcaacaatcgctggaaa
cagagtgtggagctgtgcaaaaaggataaactctataaggatgccatggaatatgcagcc
gaatcgggtaaacaagagattgctgaagaattgttgggttggttcttggaacgcaatgct
catgattgttttgcggcatgtctatatcagtgctacgacttgctgcgtccagatgtcatc
ttggaattggcctggaagcataaaatcatggactttgccatgccctatttaattcaggtt
ctacgggaatacacaagcaaggtggataaattggaattgaatgaggcgcaacgggaaaag
gaagatgataccacggagcataaaacgataattaaaatggagccacaattaatgattacc
gctggcccggctatgggtattccgcaacaatatgcccaaaattatccgcccggtgctgca
gcggcggcggcagcagctgctgctgcaacagcggcgggacgtaatatgggttatccctat
ttgtag

DBGET integrated database retrieval system