KEGG   Drosophila willistoni: Dwil_GK25305Help
Entry
Dwil_GK25305      CDS       T01067                                 

Definition
GK25305 gene product from transcript GK25305-RA
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
dwi  Drosophila willistoni
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dwil_GK25305
  Energy metabolism
   00920 Sulfur metabolism
    Dwil_GK25305
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Dwil_GK25305
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dwil_GK25305
    3.1.3.25  inositol-phosphate phosphatase
     Dwil_GK25305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 349 aa AA seqDB search
MNGRSIRINRVPATITAILFTLILVYFLNFHQEERPAIYGMLRSDNPNRVNLRKMLIAAI
QAAQRGGLEVLGVARSRQLKERSKGKTDEGVNDPFTDADARSHCVMKQGLQRIFPRVMIF
SEEDKEHCLDFNSFDLDPTVLHQTARVPDVAVNAQDVTVWVDPLDATKEFTEELYEYVTT
MVCVAVSGRPIIGVIHSPFSGQTAWAWVGNSMSEYLAGLHPTKHEETDPIITVSRSHTAG
AKDLARNVFGDKVQLLTAAGAGYKVLQVVANNASAYLHTSKIKKWDICAGDAILHALGGT
MTTLDDRLINYGPEESPVNTNGLLATLEKHAEYMDMLGKYRDTHKAKQR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacgctcaatacgcattaatcgggtgccggccaccataaccgccatcctgttc
accctgatcctggtatactttttaaacttccatcaggaggaacgtccggccatttatggg
atgctgcgcagcgacaatcctaatcgggtgaatctacgtaaaatgctcattgctgccatt
caggcagctcaacgtggcggcctggaagtgctcggtgtggctcgaagccgtcagttgaag
gagcgtagcaaggggaagacggacgagggggtcaatgacccgttcaccgatgccgatgcc
cgttcccattgtgtaatgaaacagggactacagcgtatctttccacgtgtcatgatcttc
tcggaggaggataaagaacattgcctcgatttcaattcatttgacttggatcccacagtg
ttacatcaaacggcccgtgttcccgatgtggctgtcaatgcccaagatgtaaccgtctgg
gtggatcctctagatgccaccaaagagtttacagaggaactgtacgaatatgttacgaca
atggtttgcgttgccgtttccgggcgacccatcattggggtcattcatagtccattcagc
gggcagactgcctgggcatgggttggcaattccatgtccgagtatttggctggcctgcat
cccacaaaacacgaagagaccgatcctattatcactgtatcccgctcacacacagccgga
gccaaggatctggcacgaaatgttttcggagataaggtgcaactgctaaccgctgccggt
gctggctacaaggtgctccaggtggtggcaaacaatgccagcgcctatctgcatacatcg
aaaatcaagaaatgggatatatgcgccggtgatgccatactccatgccctggggggcact
atgacaactcttgatgatcggctgatcaactatggtccggaggaatcacctgtgaatacg
aacggtctgctagccacactcgagaagcatgcggaatatatggatatgttgggcaaatat
cgtgacacacacaaagcgaaacagagatag

DBGET integrated database retrieval system