KEGG   Drosophila willistoni: Dwil_GK25575Help
Entry
Dwil_GK25575      CDS       T01067                                 

Definition
GK25575 gene product from transcript GK25575-RA
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dwi  Drosophila willistoni
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dwil_GK25575
   04330 Notch signaling pathway
    Dwil_GK25575
   04350 TGF-beta signaling pathway
    Dwil_GK25575
   04630 Jak-STAT signaling pathway
    Dwil_GK25575
   04068 FoxO signaling pathway
    Dwil_GK25575
Enzymes [BR:dwi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dwil_GK25575
Transcription factors [BR:dwi03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dwil_GK25575
Mitochondrial biogenesis [BR:dwi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dwil_GK25575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3392 aa AA seqDB search
MMADHLDEPPQKRVKMDPTDLFFLEDNLPDELVSSNSGWSDQLSGGGGGGGGSGGGPGGG
PNSQNTNTGGVVSTNASGGPNKPPAQGPGPGVGVGVGVVSTQMNGAGNGGGGGVAGSTPG
GGNNGDGSDGTVSGNGGATGAGNQQQLRQMQHHHLQHLLEQRQQQQQQQQQGQKGSMVVP
GMQQLGSSKSPNLQSPNTGMQQVAAQMGMVNSMPMSISNNGNNGMNAIPGMNTIAQGNLG
NMVLTTSGGGLGMVNQLKPQPGGGMMNAGTGPAGGAGQVVTNPIPIPNQAMHMQNGPMMG
RMVGQQHMLRGPHLGGGGNGPGNGPGGGGGPRMQNPNMQMGQINSMAYGVGNYGGPGGGG
AANPQQQQQLLAQQMAVQRGGVVPGLPQGNRPVGTVVPMSGMGAEGTPTGQQLQMQQQMN
AQQALGGPRPPQPNQLLGHPQQQQQQQPGTSQQQQQQQQQQQQQQQQPGGAVGGAPTVGA
VGGAAGGGPGVPGAGSGGGPPPPGNISDERKRQIQQQLMLLLHAHKCNRRENLNPNREVC
NVNYCKAMKAVLAHMGTCKQSKECTMQHCASSRQILLHYKTCQRNDCIICFPFRQNHSMF
QNAGSGGGGAVAGGAAGGAGGAGGGGSGVNVGAPGSLQNQNQPLAGLVSVDNKQQQQQPG
GQQQQQQVPPGGGPQNTAIVLPQQQQQQQQQPGGGGNAPKTDMTQQQQMQQQQQQQQVLQ
QQVQQQQDLRRFDGMGHVGHSPVTAGMLGATGPGGASGPGGAAQQQQTLPPGIRMQGAPP
GRVLGGPNSAGGLTNDVNSVQQQQQQQQILQGNTALAVAAAANAVGRRRGAGAGAGAGGG
GGSGGLPSMVDQQQQQQQQQQQQQQQPNAQLGHIPVPLSVNVGGGAGGGGGSGSGQQQQQ
QFNNTPQMVGGQSDQLAKLKLAQAQGHVVGPPGGNSGTPASVLMPADTSSGVGPNQTNPN
QQPNATAGGGGSVAGANNSGGGAGGTGGGGPGSSGPPSVADCEKDWRESVTADLRNHLVH
KLVQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMANSRSEYYHLLAEKIYKIQKELE
EKRLKRKEQHQQMLMQQQQQPQSQTQQQQQQQQQQQQQPVPMGGPVGPGGCVRPLISPMG
GGVMQSQQQQQPQLRPQAPVGVGGVGVGVGVGVGGVVGAGGAGGPNANMVAMRSHSPGGN
MLTIQQQQQQRMQFPQQQQPQQQQQQQPGNMLVGPPGPSPGGQMVVNPVLSPFQTASNAL
TSPVPGVPQPQQFINGQAAGGGAGGASANPLSEMMKQRLLHQQQQQQQQQQQQQTGILMP
QSPFSNATPIQQQNNFSSPMQAQQQQQQQQQQQKTQQQQQQQQQQQQQQQQQQQQQLNNM
PPTPTSLDALQAGGAASSGTGGGSAGGGSGGVNSTSSASGGGLTVSAPSPSPGFLSNGPI
GTPSNPNNNPPSVSSLMQPLSDRPATPPYIPASPVPAASASGLANSSSTPASAAATCASS
SSGSSSNGGNGNSNSNSSGGAGGATIATATTTTAPMTTASTPQSCASSSVATPTSTTAST
ASSSSSSGPGSSTLLLSSGGGGGGPTGGGGGRMISSSSSLSSQMAALEAAARDNDDDTPS
PSQDGGSGGGGMASKGKLDSIKPEDEIKKEFMDDSCGGNNDSSQMDCSTGGKGKNVNNDG
TSMIKMELKSEDGTGPDGVKIKSEPMDVDEAAAAAAAAAGGAAGGDGSSTGEGGKTDDIN
GGMDGNSGTDIKIKHETKPVVPEPLAPNAGDKKKKCQFNPEELRTALLPTLEKLLRQEPE
SVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRNNILNGKYSDPWEYVDDVWLMFDNAWLY
NRKTSRVYRYCTKLSEVFEQEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKY
YSYQNSLKEYGVASNRYTFCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLEL
EPFVDCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVY
IETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEGGEMMQEFPYRAKALFA
FEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYM
DYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQD
YKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANL
FSIEDNEVSGDGKKKGQKKAKKSNKSKAAQRKNSKKSNEHQSGNDLSAKIYATMEKHKEV
FFVIRLHSAQSAASLAPIQDPDPLLTCDLMDGRDAFLTLARDKHYEFSSLRRAQFSTLSM
LYELHNQGQDKFVYTCNHCKTAVETRYHCTVCDDFDLCTVCKEKVGHQHKMERLGFDLDD
GSAPADLKQANPQEARKQSIQRCIQSLVHACQCRDANCRLPSCTKMKRVVQHTKNCKRKT
NGGCPICKQLIALCCYHAKHCQEQKCPVPFCPNIKHKLKQQQLQQKLQQQQLLRRRVALM
SRTAAPSSLPGPVAVSGPVVSAGGVPVVGMSGVAVSQQVMPGQSGIMPPGAGGMSPSTVP
VPSPVSGGGGGGMTSPHSHQPGIGMKPGGGHSPSPNVLQVVKQVQEEAARQQVPHGGGFG
KGVAMAPPVMNRPLGVGVGGVGVPNQGVNQLGGMVGNVGVVNQMTGNVGPGGGGGGGGGN
PNAVPGAANCGGNVLSLTNLLPLDQWGGSGGPGPGGAVGQQQQRYTNNAGQVGQGPGMRQ
PPNQLMQPNAMQQQQPLHQMMGMPPNQMGGVGGVGVGVNVGVGQMPVGPSPHGMGMGGPQ
MGGAAGAGGGVRPPPGAQGQAGPNMANGPPLNTQQLNTQQLAQIMQKIKNNPTNESNQHI
LTILKQNPQIMAAIIKQRQQSQQSQLNAAAGGAPGGALQAVNGPQNPQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQQQQVMQQQQMQHMMNQQQQQQQQGGPQQMNPNQQQQVNVMQQQQQ
GGPVGPGPHQRMPSMQNAMMLQNLPPGVTTQGGMVSNQSWNKMRYMQMNQYPPPYPQRQR
GPHMGGAGQQQFPVSGGAGNFNAGGAAGVPVGAGGGGDAGPGANQYMANAAANNMLQGQG
GAGVKPGPQQQQMGVMPPGMQQQQQQQQQMMQVAMPNAQNQNPSVVGGGGGPGVVGGGGG
GGPGSNVMGPPTPHTLQQQLMQSARSSPPIRSPQPTPSPRSAPSPRAAPSASPRAQPSPH
HVMSSHSPAPQGPHDGMHNHGMHHQSPLPGVPQDVGVGVVGVGVGVGVGVGVGVGGVNVN
VGGNVGVVGQPGGGAGAMPDASDQLTKFVERL
NT seq 10179 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgatcacttagacgaaccgccccagaagcgggtcaaaatggatccaacggat
ctattctttctggaagacaatctgccagatgaattggtatcatcgaacagcggctggtca
gatcagttaagcggtggaggcggcggcggtggcggttctggcggtggtcctggcggcggt
ccaaattcacagaatacaaataccggcggtgtagtatccacaaatgccagcggcggacca
aataaaccaccagcccaaggaccaggacctggtgtcggtgtcggtgtcggtgttgtgtcc
acacaaatgaatggagccggcaatggcggcggcggcggtgttgctggctccacacctggt
ggtggcaataatggtgatggtagtgatggcaccgtcagtggtaatggtggtgcaactggt
gctggcaatcaacagcaattgcgtcaaatgcaacatcatcatctgcagcatttgctcgaa
cagcggcaacagcagcagcaacagcaacaacagggacaaaagggatcaatggtggtgcct
ggaatgcaacaattgggcagtagcaagtcaccgaatctacaatcacccaacactggcatg
cagcaagtggccgcacaaatgggcatggtcaactcaatgcccatgtccatatcgaataat
ggcaataatggaatgaacgccataccaggcatgaatacaattgcacagggcaatttgggc
aacatggtattgaccactagtggcggcggcctcggcatggtcaatcagctgaaacctcaa
cctggtggcggtatgatgaatgccggtacaggaccagctggtggcgctggccaagtggta
accaatcccatccccattcccaatcaggcgatgcatatgcaaaatggtccaatgatgggg
cgcatggtggggcaacagcatatgctccgaggaccacatctcggtggcggtggcaatggg
ccaggcaatggccccggcggaggaggtggtccacgcatgcaaaaccccaacatgcagatg
ggtcaaatcaacagcatggcgtatggtgttggcaactatggtggtcctggcggcggtggt
gccgctaatcctcaacagcagcaacagctgttggcccaacaaatggctgtccagcgtggc
ggagttgtccccggcctgccgcaaggcaatcgtcctgtgggcactgtggtgcccatgtcg
ggcatgggggcggaaggcacgcctactggccagcaattgcaaatgcaacagcaaatgaat
gcccaacaggctctaggaggtccacggccgccgcagccgaatcaattgttggggcatccg
caacagcagcagcaacaacaaccaggcacctcgcagcaacagcagcaacaacaacaacag
cagcagcagcagcaacaacagcccggtggagcagttggtggagcgcccacagttggtgct
gtcggtggtgcggcaggcggtggtccaggtgtacccggtgccggtagtggaggcggtcct
ccgccgcccggcaacatctccgatgagcgcaaacgtcaaatccagcagcaattgatgcta
ctccttcatgcccacaagtgtaaccggcgcgagaatctaaatcccaatcgggaggtatgc
aatgtcaactattgcaaggccatgaaagccgtactggcccacatgggcacgtgtaaacag
agcaaggaatgcaccatgcaacattgcgcctcgtcgcgccaaatattgctccactacaag
acctgccagcgaaatgattgtatcatttgctttccatttcgtcagaatcattcgatgttt
cagaatgccggcagtggcggcggcggtgcagttgctggcggtgccgctggtggtgctggt
ggagcgggtggcggcggtagcggtgttaatgttggcgctccgggtagtctccagaatcag
aatcaaccgcttgccggccttgtcagtgttgataacaagcagcagcagcagcaaccgggt
ggacaacagcagcaacagcaagtcccacccggaggtggtcctcagaatacagcgattgtt
ctgccacagcagcagcagcagcaacaacaacagcctggtggaggaggaaatgcgccgaaa
actgatatgacgcagcagcaacagatgcaacaacagcagcagcagcagcaagtccttcag
caacaggtacaacagcagcaagatttacggcgattcgatggcatgggtcatgtgggacat
tctccagttacagctggcatgctcggggcaacgggccctggaggtgccagcggtcctggg
ggagcggcacagcaacaacaaactctgccgccgggcatacggatgcagggtgcgccgcca
gggcgagtcctgggtggtcccaactcggcaggcggtctaaccaatgatgtcaacagtgtt
cagcagcagcaacaacaacagcaaatccttcagggtaatacggcactagccgtggccgct
gctgccaatgctgtcgggcgacgacgcggtgccggagctggtgctggagctggcggcggc
ggcggtagtggtggtctaccctctatggtcgatcaacaacagcagcagcagcagcagcaa
caacaacaacaacaacaacctaatgcccaattgggtcacattccggttccattgtccgtc
aatgtgggcggcggtgctggcggcggtggcggcagcggcagtggacagcagcagcagcag
caattcaataatacaccgcaaatggttggaggacaatccgatcagttggccaaactgaaa
ttggcacaggcccagggtcatgtagtgggtccgccgggcggtaatagcggaacgccagcc
agtgtcctgatgcctgccgatacctcaagtggcgttggtcccaatcagaccaatcccaat
cagcagccgaatgcaacagcaggcggcggcggttccgttgccggtgcaaacaattccggc
ggtggtgctggcggcactggtggtggtggtcctggttcaagtggaccaccctcggtggcc
gattgtgagaaagattggcgggaatctgtgacagcggatttacgcaatcatttggtccac
aagcttgttcaggccatttttcctacctccgatccaacaacaatgcaggacaagcgcatg
cataatcttgtatcctatgccgaaaaggtcgaaaaggatatgtacgagatggccaattcg
cgttccgaatattatcatctgctcgccgaaaagatctacaagatccaaaaggagttggaa
gagaagcgacttaagcgcaaagagcagcatcagcagatgttaatgcaacaacaacagcaa
cctcaatcacaaacgcagcaacagcagcagcagcagcagcaacaacaacaacagcctgtt
ccaatgggcggtccagttggtcccggtggttgtgtgcgtccactaatcagtcccatgggc
ggtggtgtaatgcaatcgcagcaacaacagcagccccaattgcgaccacaggccccagtt
ggtgttggcggcgttggcgtcggcgtcggtgtcggtgtcggcggcgtcgtcggtgctggc
ggtgctggtggaccaaatgcaaatatggtggccatgcgtagtcattcacctggtggcaat
atgctaaccatacagcagcaacagcaacagcgtatgcaattcccgcagcaacagcaaccg
caacaacagcagcagcaacagcctggcaatatgctggtcggaccacctggaccgagtcct
ggtggtcaaatggtagtcaatcctgtactctcacctttccaaacagctagcaatgcccta
accagtccggtgccgggtgtccctcagccccaacagtttatcaatggacaagctgcgggc
ggaggagctggcggagcttcagcgaatccgctaagtgagatgatgaagcagagattactt
catcaacagcagcagcagcagcaacaacaacaacaacaacagactggcatattaatgccc
caatcgccttttagtaatgccacgcccattcagcagcaaaataactttagttcgcccatg
caagcgcagcaacagcagcagcagcagcagcaacaacaaaagacccaacaacagcagcag
cagcagcaacaacaacaacaacaacagcagcagcagcagcaacaacaactgaataatatg
ccaccaacacccaccagtttagatgccctacaagcgggcggtgcagcatcgagcggcacg
ggaggaggaagtgcaggtggtggtagtggtggtgtcaattccacatcatcggcatcgggc
ggtggtttaacggtttccgcaccaagtccatcgcctggctttctgtccaatggccccatt
ggtacaccatcaaatccaaataacaatccgccctccgtttccagtttaatgcaaccgctg
agcgatcggccggcgactcctccgtacataccagcctcaccagtgccggcggcatcggca
tccggtttggccaatagcagtagcaccccagcctcggcggcagccacatgtgcaagcagc
agcagcggcagtagcagcaacggcggcaacgggaacagtaatagcaacagcagtggtggc
gccggcggtgcaaccatagccacagccaccaccacaacggcaccaatgacgacggccagt
acgccgcagagttgtgcctcctcatcggtggccacacccacatcgacaacagcctccacc
gcgtcatcatcatcgtcgtcgggaccaggcagttcgacattattgctgagcagtggcggt
ggcggtggtggaccaacgggaggcggtggtggccgaatgattagttcgagcagtagtcta
tcctctcagatggccgccttggaggcggcagcccgtgataatgacgatgatacgccatca
cccagtcaagatggcggcagtggtggcggtggtatggcctccaagggtaaactcgattcc
attaagccagaggatgagatcaaaaaggagtttatggacgatagttgcggcggcaacaac
gatagctcccaaatggactgctcgacgggtggcaagggcaagaatgtcaataacgatggc
accagcatgatcaaaatggaactcaaatccgaggatggcaccggacccgatggtgttaaa
atcaaatccgagccaatggatgtggatgaggcagctgctgcagcagcggcagccgccggc
ggtgcagcgggcggtgatggcagttcaactggcgaaggcggcaaaacggatgatattaat
ggcggtatggatggtaacagtggaactgatattaaaattaagcatgaaaccaaaccagtt
gtgcccgaaccattggcaccaaatgcaggcgacaagaagaaaaagtgtcaattcaatcca
gaagagctacgaaccgcattgttgccaacattggagaaacttttgcgtcaggagcccgaa
tcggtgccatttcgctatccggttgatccacaagctctcggtatacccgattactttgag
attgttaaaaagcccatggatctgggcacaatacgcaacaatatactcaatggcaaatac
agtgatccctgggaatatgtggatgatgtttggttaatgtttgataatgcctggctatat
aatcgcaagacatcgcgcgtttatcgctattgtactaagttatcggaggtctttgagcag
gaaatcgatcctgttatgcaggccttgggctattgctgtggacgcaaatacactttcaat
ccgcaagtgctctgctgttatggcaaacaattgtgcacaattccgcgtgatgccaagtat
tatagttatcagaatagtctaaaggaatacggtgttgcctcaaatagatacacgttctgc
caaaagtgctttaatgacatacaaggagacactgtcacattgggcgatgatccgctgcag
tctcaaacacaaatcaaaaaggatcaattcaaagagatgaaaaacgatcatctcgagttg
gaaccctttgtcgattgccaggaatgtggacgcaaacaacatcagatttgtgtcctctgg
ttggattcgatttggccaggtggctttgtctgcgataattgcctgaaaaagaagaactct
aagcgaaaggagaataaatttaatgccaaacgtttacccaccacaaaattgggcgtctat
attgaaacgcgagtgaataacttcctgaagaagaaggaagccggcgctggtgaggttcat
atacgtgtggtcagctcgtcggacaagtgtgtggaagtcaaaccgggaatgcggcgtcgt
tttgtcgagggtggcgaaatgatgcaagagtttccatacagagccaaagctttattcgcc
ttcgaggaggtcgatggcattgatgtgtgtttctttggcatgcatgtccaggagtatggt
tccgagtgtccggcaccgaatacacgacgcgtctatattgcatatctggattcggttcac
ttctttcgcccgcggcaatatcgtacggctgtttatcatgagattctgcttggctatatg
gattatgtgaaacaattgggctatactatggcccacatttgggcatgtccgccatcggag
ggcgatgattatatattccattgtcatccgacagatcagaaaattccaaagccaaagcga
ttacaggaatggtataagaagatgctcgacaagggtatgattgagcgtatcatacaggac
tataaggatatacttaagcaggccatggaggataaattgggttcggctgctgaattgcca
tactttgagggtgatttctggcccaatgtgctcgaagagagtatcaaagaacttgaccaa
gaggaggaagagaaacgtaaacaagccgaggcagcagaagcagcagcggcggcaaatctc
ttctccattgaggacaacgaggtcagtggtgatggcaaaaagaagggccaaaagaaggcg
aaaaaatcaaataaatcaaaagcagcgcaacgaaagaatagcaaaaaatcgaatgaacat
cagtcgggcaatgatttgtcggctaaaatttatgccaccatggagaagcataaagaagta
ttctttgtgatacgtttacattcggctcaatcggcagccagcttagcgcccatccaagac
cctgatccattgctaacctgtgatctaatggatggacgtgatgctttcctaacactcgcc
cgcgataagcattatgaattctcctctctgcgtcgtgcccaattctcgacattgtccatg
ctctatgagctgcataaccagggtcaggataaattcgtctatacctgtaatcattgcaag
acagccgtggagacgcgctatcattgcactgtctgtgatgactttgatctatgcactgtg
tgcaaggagaaagtcggccatcaacataaaatggagagacttggctttgatctggatgat
ggttcagcgccagccgatctcaagcaagcaaatcctcaagaggcacgcaaacagtccata
caacgttgcattcaatctctcgtccatgcctgccaatgtcgcgatgccaattgtcgtctg
ccatcgtgcacgaagatgaagcgagtcgttcagcatacaaagaactgcaagcgaaagaca
aatggcggttgccccatatgcaagcaattgattgcgctctgttgctatcatgccaagcat
tgtcaggagcagaagtgtccagtgcccttctgtccgaatatcaagcacaagctgaagcag
cagcaattacagcaaaaactccagcagcagcaattgttgcgtcgtcgtgtggctcttatg
tcaagaacggcggctccatcatcgttgcctggtccagtggcggtaagcggacccgttgta
tcggctggcggtgtacccgtcgtcggcatgtccggtgtggctgttagccaacaagtgatg
cccggccaaagtggcattatgccaccaggagctggcggaatgtcgccatcaacggtccca
gtgccctcgcctgtgtcgggcggtggcggaggcggcatgacatcgccgcattcacatcag
ccgggcattggcatgaagccgggtggaggtcattcaccctcgcccaatgtgctgcaggtg
gtgaagcaggtacaagaggaggccgctcgtcaacaggtgccgcatggcggtggctttggc
aagggtgtggcgatggcgccgcctgtcatgaatcgaccgctaggcgtcggtgttggcggt
gtgggtgtgcccaatcagggcgtgaatcagctgggcggcatggttggcaatgttggtgtg
gttaatcaaatgactggcaatgtgggacccggtggtggtggcggcggcggcggtggcaat
ccaaatgccgtgcccggtgcagccaactgcggcggcaatgttctgagcctaaccaatctc
ctgcccttggatcaatggggcggcagtggcggacccggacccggtggagcagttggacag
caacagcagcgttataccaataatgccggccaggtgggtcagggacctggcatgagacag
ccaccgaatcagctaatgcaaccgaatgccatgcaacagcagcaaccgctgcaccaaatg
atgggaatgccacccaatcagatgggcggagttggtggagtgggcgtcggtgttaatgtt
ggtgttggtcaaatgcctgtcggtccctcgccacacggcatgggcatgggtggtccccaa
atgggtggtgctgccggtgccggcggcggagttcgtccgccacccggtgcccagggtcag
gccggaccaaacatggccaatggtccgccattgaatacgcagcaattgaatacccaacag
ttggctcaaataatgcaaaagatcaaaaataatccaaccaatgagagcaaccagcatatc
cttaccatactcaagcagaatcctcagattatggctgccattatcaagcagcgtcagcag
agtcagcaaagtcagttgaatgcggcagctggtggtgcacctggtggtgccctgcaggct
gtcaatgggccgcagaatcctcagcaacagcagcagcaacaacaacaacagcagcaacaa
caacaacagcagcagcagcaacagcagcagcaacaacaacagcagcagcagcaagtgatg
cagcaacaacaaatgcagcatatgatgaatcaacaacaacaacaacaacaacagggcgga
ccacaacaaatgaatcccaatcagcagcagcaggtgaatgtcatgcaacagcagcaacaa
ggtggccccgttggacctgggccacatcaacgtatgccgagcatgcagaatgccatgatg
ttgcagaatctaccgcccggcgttaccacccaaggtggcatggtttcgaatcaaagttgg
aataagatgcgttatatgcaaatgaatcaatacccgccaccgtatccgcaacgccaacgt
ggcccacatatgggtggagccggccaacagcaattccccgttagcggcggtgccggcaat
ttcaatgccggcggcgcagccggtgtaccagtaggtgcaggcggtggcggagacgctggc
cctggagccaatcaatatatggcaaatgcggcggccaacaatatgctgcagggacagggc
ggtgccggtgtgaagcccggtccgcagcaacagcaaatgggcgtaatgccgccaggtatg
caacagcagcagcagcagcaacagcaaatgatgcaggtggccatgccgaatgctcagaat
cagaatccatctgttgttggcggtggcggcggccctggtgtggttggtggcggcggcggc
ggcgggcccggctcgaatgtaatgggcccacccacgccgcacaccctgcagcaacaattg
atgcaatcagcccgctcatcaccgcccatacgttccccgcagccaacaccatcgccgcga
tcggcgccatcgcccagagcggcaccatcggcctcgccgcgtgcccaaccctcgccgcat
catgtgatgagcagccattcaccggcaccgcaaggtccccacgatggtatgcataatcat
gggatgcatcatcagtcgcctctgccgggtgtaccccaggatgtgggcgttggtgttgtc
ggtgtcggtgtcggcgttggtgttggtgttggtgtcggtgttggcggtgtcaatgtcaat
gttggcggcaatgtgggtgttgttggccagccaggtggtggcgccggtgccatgcccgat
gcatctgatcaattgacaaaatttgtagagagactctag

DBGET integrated database retrieval system