KEGG   Drosophila willistoni: Dwil_GK25575Help
Entry
Dwil_GK25575      CDS       T01067                                 

Definition
(RefSeq) GK25575 gene product from transcript GK25575-RB
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dwi  Drosophila willistoni
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dwil_GK25575
   04330 Notch signaling pathway
    Dwil_GK25575
   04350 TGF-beta signaling pathway
    Dwil_GK25575
   04068 FoxO signaling pathway
    Dwil_GK25575
Enzymes [BR:dwi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dwil_GK25575
Transcription factors [BR:dwi03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dwil_GK25575
Chromosome [BR:dwi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dwil_GK25575
Mitochondrial biogenesis [BR:dwi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dwil_GK25575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 3257 aa AA seqDB search
MMADHLDEPPQKRVKMDPTDLFFLEDNLPDELVSSNSGWSDQLSGGGGGGGGSGGGPGGG
PNSQNTNTGGVVSTNASGGPNKPPAQGPGPGVGVGVGVVSTQMNGAGNGGGGGVAGSTPG
GGNNGDGSDGTVSGNGGATGAGNQQQLRQMQHHHLQHLLEQRQQQQQQQQQGQKGSMVVP
GMQQLGSSKSPNLQSPNTGMQQVAAQMGMVNSMPMSISNNGNNGMNAIPGMNTIAQGNLG
NMVLTTSGGGLGMVNQLKPQPGGGMMNAGTGPAGGAGQVVTNPIPIPNQAMHMQNGPMMG
RMVGQQHMLRGPHLGGGGNGPGNGPGGGGGPRMQNPNMQMGQINSMAYGVGNYGGPGGGG
AANPQQQQQLLAQQMAVQRGGVVPGLPQGNRPVGTVVPMSGMGAEGTPTGQQLQMQQQMN
AQQALGGPRPPQPNQLLGHPQQQQQQQPGTSQQQQQQQQQQQQQQQQPGGAVGGAPTVGA
VGGAAGGGPGVPGAGSGGGPPPPGNISDERKRQIQQQLMLLLHAHKCNRRENLNPNREVC
NVNYCKAMKAVLAHMGTCKQSKECTMQHCASSRQILLHYKTCQRNDCIICFPFRQNHSMF
QNAGSGGGGAVAGGAAGGAGGAGQQQQQQVPPGGGPQNTAIVLPQQQQQQQQQPGGGGNA
PKTDMTQQQQMQQQQQQQQVLQQQVQQQQDLRRFDGMGHVGHSPVTAGMLGATGPGGASG
PGGAAQQQQTLPPGIRMQGAPPGRVLGGPNSAGGLTNDVNSVQQQQQQQQILQGNTALAV
AAAANAVGRRRGAGAGAGAGGGGGSGGLPSMVDQQQQQQQQQQQQQQQPNAQLGHIPVPL
SVNVGGGAGGEQQFNNTPQMVGGQSDQLAKLKLAQAQGHVVGPPGGNSGTPASVLMPADT
SSGVGPNQTNPNQQPNATAGGGGSVAGANNSGGGAGGTGGGGPGSSGPPSVADCEKDWRE
SVTADLRNHLVHKLVQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMANSRSEYYHLL
AEKIYKIQKELEEKRLKRKEQHQQMLMQQQQQPQSQTQQQQQQQQQQQQQPVPMGGPVGP
GGCVRPLISPMGGGVMQSQQQQQPQLRPQAPVGVGGVGVGQQQQPGNMLVGPPGPSPGGQ
MVVNPVLSPFQTASNALTSPVPGVPQPQQFINGQAAGGGAGGASANPLSEMMKQRLLHQQ
QQQQQQQQQQQTGILMPQSPFSNATPIQQQNNFSSPMQAQQQQQQQQQQQKTQQQQQQQQ
QQQQQQQQQQQQQLNNMPPTPTSLDALQAGGAASSGTGGGSAGGGSGGVNSTSSASGGGL
TVSAPSPSPGFLSNGPIGTPSNPNNNPPSVSSLMQPLSDRPATPPYIPASPVPAASASGL
ANSSSTPASAAATCASSSSGSSSNGGNGNSNSNSSGGAGGATIATATTTTAPMTTASTPQ
SCASSSVATPTSTTASTASSSSSSGPGSSTLLLSSGGGGGGPTGGGGGRMISSSSSLSSQ
MAALEAAARDNDDDTPSPSQDGGSGGGGMASKGKLDSIKPEDEIKKEFMDDSCGGNNDSS
QMDCSTGGKGKNVNNDGTSMIKMELKSEDGTGPDGVKIKSEPMDVDEAAAAAAAAAGGAA
GGDGSSTGEGGKTDDINGGMDGNSGTDIKIKHETKPVVPEPLAPNAGDKKKKCQFNPEEL
RTALLPTLEKLLRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRNNILNGKYSDP
WEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEQEIDPVMQALGYCCGRKYTFNPQV
LCCYGKQLCTIPRDAKYYSYQNSLKEYGVASNRYTFCQKCFNDIQGDTVTLGDDPLQSQT
QIKKDQFKEMKNDHLELEPFVDCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRK
ENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVE
GGEMMQEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFR
PRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQE
WYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEE
EKRKQAEAAEAAAAANLFSIEDNEVSGDGKKKGQKKAKKSNKSKAAQRKNSKKSNEHQSG
NDLSAKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLMDGRDAFLTLARDK
HYEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTAVETRYHCTVCDDFDLCTVCKE
KVGHQHKMERLGFDLDDGSAPADLKQANPQEARKQSIQRCIQSLVHACQCRDANCRLPSC
TKMKRVVQHTKNCKRKTNGGCPICKQLIALCCYHAKHCQEQKCPVPFCPNIKHKLKQQQL
QQKLQQQQLLRRRVALMSRTAAPSSLPGPVAVSGPVVSAGGVPVVGMSGVAVSQQVMPGQ
SGIMPPGAGGMSPSTVPVPSPVSGGGGGGMTSPHSHQPGIGMKPGGGHSPSPNVLQVVKQ
VQEEAARQQVPHGGGFGKGVAMAPPVMNRPLGVGVGGVGVPNQGVNQLGGMVGNVGVVNQ
MTGNVGPGGGGGGGGGNPNAVPGAANCGGNVLSLTNLLPLDQWGGSGGPGPGGAVGQQQQ
RYTNNAGQVGQGPGMRQPPNQLMQPNAMQQQQPLHQMMGMPPNQMGGVGGVGVGVNVGVG
QMPVGPSPHGMGMGGPQMGGAAGAGGGVRPPPGAQGQAGPNMANGPPLNTQQLNTQQLAQ
IMQKIKNNPTNESNQHILTILKQNPQIMAAIIKQRQQSQQSQLNAAAGGAPGGALQAVNG
PQNPQQQQQQQHMMNQQQQQQQQGGPQQMNPNQQQQVNVMQQQQQGGPVGPGPHQRMPSM
QNAMMLQNLPPGVTTQGGMVSNQSWNKMRYMQMNQYPPPYPQRQRGPHMGGAGQQQFPVS
GGAGNFNAGGAAGVPVGAGGGGDAGPGANQYMANAAANNMLQGQGGAGVKPGPQQQQMGV
MPPGMQQQQQQQQQMMQVAMPNAQNQNPSVVGGGGGPGVVGGGGGGGPGSNVMGPPTPHT
LQQQLMQSARSSPPIRSPQPTPSPRSAPSPRAAPSASPRAQPSPHHVMSSHSPAPQGPHD
GMHNHGMHHQSPLPGVPQDVGVGVVGVGVGVGVGVGVGVGGVNVNVGGNVGVVGQPGGGA
GAMPDASDQLTKFVERL
NT seq 9774 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgatcacttagacgaaccgccccagaagcgggtcaaaatggatccaacggat
ctattctttctggaagacaatctgccagatgaattggtatcatcgaacagcggctggtca
gatcagttaagcggtggaggcggcggcggtggcggttctggcggtggtcctggcggcggt
ccaaattcacagaatacaaataccggcggtgtagtatccacaaatgccagcggcggacca
aataaaccaccagcccaaggaccaggacctggtgtcggtgtcggtgtcggtgttgtgtcc
acacaaatgaatggagccggcaatggcggcggcggcggtgttgctggctccacacctggt
ggtggcaataatggtgatggtagtgatggcaccgtcagtggtaatggtggtgcaactggt
gctggcaatcaacagcaattgcgtcaaatgcaacatcatcatctgcagcatttgctcgaa
cagcggcaacagcagcagcaacagcaacaacagggacaaaagggatcaatggtggtgcct
ggaatgcaacaattgggcagtagcaagtcaccgaatctacaatcacccaacactggcatg
cagcaagtggccgcacaaatgggcatggtcaactcaatgcccatgtccatatcgaataat
ggcaataatggaatgaacgccataccaggcatgaatacaattgcacagggcaatttgggc
aacatggtattgaccactagtggcggcggcctcggcatggtcaatcagctgaaacctcaa
cctggtggcggtatgatgaatgccggtacaggaccagctggtggcgctggccaagtggta
accaatcccatccccattcccaatcaggcgatgcatatgcaaaatggtccaatgatgggg
cgcatggtggggcaacagcatatgctccgaggaccacatctcggtggcggtggcaatggg
ccaggcaatggccccggcggaggaggtggtccacgcatgcaaaaccccaacatgcagatg
ggtcaaatcaacagcatggcgtatggtgttggcaactatggtggtcctggcggcggtggt
gccgctaatcctcaacagcagcaacagctgttggcccaacaaatggctgtccagcgtggc
ggagttgtccccggcctgccgcaaggcaatcgtcctgtgggcactgtggtgcccatgtcg
ggcatgggggcggaaggcacgcctactggccagcaattgcaaatgcaacagcaaatgaat
gcccaacaggctctaggaggtccacggccgccgcagccgaatcaattgttggggcatccg
caacagcagcagcaacaacaaccaggcacctcgcagcaacagcagcaacaacaacaacag
cagcagcagcagcaacaacagcccggtggagcagttggtggagcgcccacagttggtgct
gtcggtggtgcggcaggcggtggtccaggtgtacccggtgccggtagtggaggcggtcct
ccgccgcccggcaacatctccgatgagcgcaaacgtcaaatccagcagcaattgatgcta
ctccttcatgcccacaagtgtaaccggcgcgagaatctaaatcccaatcgggaggtatgc
aatgtcaactattgcaaggccatgaaagccgtactggcccacatgggcacgtgtaaacag
agcaaggaatgcaccatgcaacattgcgcctcgtcgcgccaaatattgctccactacaag
acctgccagcgaaatgattgtatcatttgctttccatttcgtcagaatcattcgatgttt
cagaatgccggcagtggcggcggcggtgcagttgctggcggtgccgctggtggtgctggt
ggagcgggtcaacagcagcaacagcaagtcccacccggaggtggtcctcagaatacagcg
attgttctgccacagcagcagcagcagcaacaacaacagcctggtggaggaggaaatgcg
ccgaaaactgatatgacgcagcagcaacagatgcaacaacagcagcagcagcagcaagtc
cttcagcaacaggtacaacagcagcaagatttacggcgattcgatggcatgggtcatgtg
ggacattctccagttacagctggcatgctcggggcaacgggccctggaggtgccagcggt
cctgggggagcggcacagcaacaacaaactctgccgccgggcatacggatgcagggtgcg
ccgccagggcgagtcctgggtggtcccaactcggcaggcggtctaaccaatgatgtcaac
agtgttcagcagcagcaacaacaacagcaaatccttcagggtaatacggcactagccgtg
gccgctgctgccaatgctgtcgggcgacgacgcggtgccggagctggtgctggagctggc
ggcggcggcggtagtggtggtctaccctctatggtcgatcaacaacagcagcagcagcag
cagcaacaacaacaacaacaacaacctaatgcccaattgggtcacattccggttccattg
tccgtcaatgtgggcggcggtgctggcggcgagcagcaattcaataatacaccgcaaatg
gttggaggacaatccgatcagttggccaaactgaaattggcacaggcccagggtcatgta
gtgggtccgccgggcggtaatagcggaacgccagccagtgtcctgatgcctgccgatacc
tcaagtggcgttggtcccaatcagaccaatcccaatcagcagccgaatgcaacagcaggc
ggcggcggttccgttgccggtgcaaacaattccggcggtggtgctggcggcactggtggt
ggtggtcctggttcaagtggaccaccctcggtggccgattgtgagaaagattggcgggaa
tctgtgacagcggatttacgcaatcatttggtccacaagcttgttcaggccatttttcct
acctccgatccaacaacaatgcaggacaagcgcatgcataatcttgtatcctatgccgaa
aaggtcgaaaaggatatgtacgagatggccaattcgcgttccgaatattatcatctgctc
gccgaaaagatctacaagatccaaaaggagttggaagagaagcgacttaagcgcaaagag
cagcatcagcagatgttaatgcaacaacaacagcaacctcaatcacaaacgcagcaacag
cagcagcagcagcagcaacaacaacaacagcctgttccaatgggcggtccagttggtccc
ggtggttgtgtgcgtccactaatcagtcccatgggcggtggtgtaatgcaatcgcagcaa
caacagcagccccaattgcgaccacaggccccagttggtgttggcggcgttggcgtcggc
cagcagcaacagcctggcaatatgctggtcggaccacctggaccgagtcctggtggtcaa
atggtagtcaatcctgtactctcacctttccaaacagctagcaatgccctaaccagtccg
gtgccgggtgtccctcagccccaacagtttatcaatggacaagctgcgggcggaggagct
ggcggagcttcagcgaatccgctaagtgagatgatgaagcagagattacttcatcaacag
cagcagcagcagcaacaacaacaacaacaacagactggcatattaatgccccaatcgcct
tttagtaatgccacgcccattcagcagcaaaataactttagttcgcccatgcaagcgcag
caacagcagcagcagcagcagcaacaacaaaagacccaacaacagcagcagcagcagcaa
caacaacaacaacaacagcagcagcagcagcaacaacaactgaataatatgccaccaaca
cccaccagtttagatgccctacaagcgggcggtgcagcatcgagcggcacgggaggagga
agtgcaggtggtggtagtggtggtgtcaattccacatcatcggcatcgggcggtggttta
acggtttccgcaccaagtccatcgcctggctttctgtccaatggccccattggtacacca
tcaaatccaaataacaatccgccctccgtttccagtttaatgcaaccgctgagcgatcgg
ccggcgactcctccgtacataccagcctcaccagtgccggcggcatcggcatccggtttg
gccaatagcagtagcaccccagcctcggcggcagccacatgtgcaagcagcagcagcggc
agtagcagcaacggcggcaacgggaacagtaatagcaacagcagtggtggcgccggcggt
gcaaccatagccacagccaccaccacaacggcaccaatgacgacggccagtacgccgcag
agttgtgcctcctcatcggtggccacacccacatcgacaacagcctccaccgcgtcatca
tcatcgtcgtcgggaccaggcagttcgacattattgctgagcagtggcggtggcggtggt
ggaccaacgggaggcggtggtggccgaatgattagttcgagcagtagtctatcctctcag
atggccgccttggaggcggcagcccgtgataatgacgatgatacgccatcacccagtcaa
gatggcggcagtggtggcggtggtatggcctccaagggtaaactcgattccattaagcca
gaggatgagatcaaaaaggagtttatggacgatagttgcggcggcaacaacgatagctcc
caaatggactgctcgacgggtggcaagggcaagaatgtcaataacgatggcaccagcatg
atcaaaatggaactcaaatccgaggatggcaccggacccgatggtgttaaaatcaaatcc
gagccaatggatgtggatgaggcagctgctgcagcagcggcagccgccggcggtgcagcg
ggcggtgatggcagttcaactggcgaaggcggcaaaacggatgatattaatggcggtatg
gatggtaacagtggaactgatattaaaattaagcatgaaaccaaaccagttgtgcccgaa
ccattggcaccaaatgcaggcgacaagaagaaaaagtgtcaattcaatccagaagagcta
cgaaccgcattgttgccaacattggagaaacttttgcgtcaggagcccgaatcggtgcca
tttcgctatccggttgatccacaagctctcggtatacccgattactttgagattgttaaa
aagcccatggatctgggcacaatacgcaacaatatactcaatggcaaatacagtgatccc
tgggaatatgtggatgatgtttggttaatgtttgataatgcctggctatataatcgcaag
acatcgcgcgtttatcgctattgtactaagttatcggaggtctttgagcaggaaatcgat
cctgttatgcaggccttgggctattgctgtggacgcaaatacactttcaatccgcaagtg
ctctgctgttatggcaaacaattgtgcacaattccgcgtgatgccaagtattatagttat
cagaatagtctaaaggaatacggtgttgcctcaaatagatacacgttctgccaaaagtgc
tttaatgacatacaaggagacactgtcacattgggcgatgatccgctgcagtctcaaaca
caaatcaaaaaggatcaattcaaagagatgaaaaacgatcatctcgagttggaacccttt
gtcgattgccaggaatgtggacgcaaacaacatcagatttgtgtcctctggttggattcg
atttggccaggtggctttgtctgcgataattgcctgaaaaagaagaactctaagcgaaag
gagaataaatttaatgccaaacgtttacccaccacaaaattgggcgtctatattgaaacg
cgagtgaataacttcctgaagaagaaggaagccggcgctggtgaggttcatatacgtgtg
gtcagctcgtcggacaagtgtgtggaagtcaaaccgggaatgcggcgtcgttttgtcgag
ggtggcgaaatgatgcaagagtttccatacagagccaaagctttattcgccttcgaggag
gtcgatggcattgatgtgtgtttctttggcatgcatgtccaggagtatggttccgagtgt
ccggcaccgaatacacgacgcgtctatattgcatatctggattcggttcacttctttcgc
ccgcggcaatatcgtacggctgtttatcatgagattctgcttggctatatggattatgtg
aaacaattgggctatactatggcccacatttgggcatgtccgccatcggagggcgatgat
tatatattccattgtcatccgacagatcagaaaattccaaagccaaagcgattacaggaa
tggtataagaagatgctcgacaagggtatgattgagcgtatcatacaggactataaggat
atacttaagcaggccatggaggataaattgggttcggctgctgaattgccatactttgag
ggtgatttctggcccaatgtgctcgaagagagtatcaaagaacttgaccaagaggaggaa
gagaaacgtaaacaagccgaggcagcagaagcagcagcggcggcaaatctcttctccatt
gaggacaacgaggtcagtggtgatggcaaaaagaagggccaaaagaaggcgaaaaaatca
aataaatcaaaagcagcgcaacgaaagaatagcaaaaaatcgaatgaacatcagtcgggc
aatgatttgtcggctaaaatttatgccaccatggagaagcataaagaagtattctttgtg
atacgtttacattcggctcaatcggcagccagcttagcgcccatccaagaccctgatcca
ttgctaacctgtgatctaatggatggacgtgatgctttcctaacactcgcccgcgataag
cattatgaattctcctctctgcgtcgtgcccaattctcgacattgtccatgctctatgag
ctgcataaccagggtcaggataaattcgtctatacctgtaatcattgcaagacagccgtg
gagacgcgctatcattgcactgtctgtgatgactttgatctatgcactgtgtgcaaggag
aaagtcggccatcaacataaaatggagagacttggctttgatctggatgatggttcagcg
ccagccgatctcaagcaagcaaatcctcaagaggcacgcaaacagtccatacaacgttgc
attcaatctctcgtccatgcctgccaatgtcgcgatgccaattgtcgtctgccatcgtgc
acgaagatgaagcgagtcgttcagcatacaaagaactgcaagcgaaagacaaatggcggt
tgccccatatgcaagcaattgattgcgctctgttgctatcatgccaagcattgtcaggag
cagaagtgtccagtgcccttctgtccgaatatcaagcacaagctgaagcagcagcaatta
cagcaaaaactccagcagcagcaattgttgcgtcgtcgtgtggctcttatgtcaagaacg
gcggctccatcatcgttgcctggtccagtggcggtaagcggacccgttgtatcggctggc
ggtgtacccgtcgtcggcatgtccggtgtggctgttagccaacaagtgatgcccggccaa
agtggcattatgccaccaggagctggcggaatgtcgccatcaacggtcccagtgccctcg
cctgtgtcgggcggtggcggaggcggcatgacatcgccgcattcacatcagccgggcatt
ggcatgaagccgggtggaggtcattcaccctcgcccaatgtgctgcaggtggtgaagcag
gtacaagaggaggccgctcgtcaacaggtgccgcatggcggtggctttggcaagggtgtg
gcgatggcgccgcctgtcatgaatcgaccgctaggcgtcggtgttggcggtgtgggtgtg
cccaatcagggcgtgaatcagctgggcggcatggttggcaatgttggtgtggttaatcaa
atgactggcaatgtgggacccggtggtggtggcggcggcggcggtggcaatccaaatgcc
gtgcccggtgcagccaactgcggcggcaatgttctgagcctaaccaatctcctgcccttg
gatcaatggggcggcagtggcggacccggacccggtggagcagttggacagcaacagcag
cgttataccaataatgccggccaggtgggtcagggacctggcatgagacagccaccgaat
cagctaatgcaaccgaatgccatgcaacagcagcaaccgctgcaccaaatgatgggaatg
ccacccaatcagatgggcggagttggtggagtgggcgtcggtgttaatgttggtgttggt
caaatgcctgtcggtccctcgccacacggcatgggcatgggtggtccccaaatgggtggt
gctgccggtgccggcggcggagttcgtccgccacccggtgcccagggtcaggccggacca
aacatggccaatggtccgccattgaatacgcagcaattgaatacccaacagttggctcaa
ataatgcaaaagatcaaaaataatccaaccaatgagagcaaccagcatatccttaccata
ctcaagcagaatcctcagattatggctgccattatcaagcagcgtcagcagagtcagcaa
agtcagttgaatgcggcagctggtggtgcacctggtggtgccctgcaggctgtcaatggg
ccgcagaatcctcagcaacagcagcagcaacaacatatgatgaatcaacaacaacaacaa
caacaacagggcggaccacaacaaatgaatcccaatcagcagcagcaggtgaatgtcatg
caacagcagcaacaaggtggccccgttggacctgggccacatcaacgtatgccgagcatg
cagaatgccatgatgttgcagaatctaccgcccggcgttaccacccaaggtggcatggtt
tcgaatcaaagttggaataagatgcgttatatgcaaatgaatcaatacccgccaccgtat
ccgcaacgccaacgtggcccacatatgggtggagccggccaacagcaattccccgttagc
ggcggtgccggcaatttcaatgccggcggcgcagccggtgtaccagtaggtgcaggcggt
ggcggagacgctggccctggagccaatcaatatatggcaaatgcggcggccaacaatatg
ctgcagggacagggcggtgccggtgtgaagcccggtccgcagcaacagcaaatgggcgta
atgccgccaggtatgcaacagcagcagcagcagcaacagcaaatgatgcaggtggccatg
ccgaatgctcagaatcagaatccatctgttgttggcggtggcggcggccctggtgtggtt
ggtggcggcggcggcggcgggcccggctcgaatgtaatgggcccacccacgccgcacacc
ctgcagcaacaattgatgcaatcagcccgctcatcaccgcccatacgttccccgcagcca
acaccatcgccgcgatcggcgccatcgcccagagcggcaccatcggcctcgccgcgtgcc
caaccctcgccgcatcatgtgatgagcagccattcaccggcaccgcaaggtccccacgat
ggtatgcataatcatgggatgcatcatcagtcgcctctgccgggtgtaccccaggatgtg
ggcgttggtgttgtcggtgtcggtgtcggcgttggtgttggtgttggtgtcggtgttggc
ggtgtcaatgtcaatgttggcggcaatgtgggtgttgttggccagccaggtggtggcgcc
ggtgccatgcccgatgcatctgatcaattgacaaaatttgtagagagactctag

DBGET integrated database retrieval system