KEGG   Drosophila willistoni: Dwil_GK25613Help
Entry
Dwil_GK25613      CDS       T01067                                 

Definition
GK25613 gene product from transcript GK25613-RA
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dwi  Drosophila willistoni
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dwil_GK25613
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dwil_GK25613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 310 aa AA seqDB search
MSDSTIEVLVFGSAIIDFICYTPRLPRPGETLHGHKFQKGYGGKGANQCVAAARQGSRTA
LIAKLGDDTFGTDYLQQLRKEGINVNHVNLLANHTTGVAQIAVSDGGENNIIIVVGANNK
LGSDDVSLAKNVFKEAKVLVCQLETPLEATVTALKAFRHGVSIVNAAPAMDQTPKELLEL
ATIFCVNETEAALMTQVDSIVGIKQAEAAIARLFEMGANTVIITLGKLGAVFGHKETPTK
FEHVPAPHVPPCKVVDTTGAGDAFIGALAHNLARYSERSLGEHIAAASAVASQSVQLPGT
QASFPYATTS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattccacaatagaagttctggtatttggttctgccataattgatttcatatgc
tacactccgcgacttccgcgacctggtgagacgctacatggccataaattccaaaaaggc
tacggtggcaaaggagccaaccaatgtgttgccgccgcccgccaaggctctcgtactgca
ttgatagccaaactgggcgatgacaccttcggcactgattaccttcagcaattacggaag
gaaggcatcaatgtgaaccatgtgaatctgcttgcaaaccataccacgggcgttgcccag
atcgccgtctctgatggaggtgaaaataatatcatcattgttgtgggtgccaacaataag
cttggctctgatgatgtgtcgcttgcaaagaatgtgttcaaggaggccaaggtgctggtc
tgtcagttggagacaccgctggaagctacagtcacagcccttaaggccttccggcatggt
gtgtctatagtgaatgcagctcctgccatggatcagacgcccaaagagcttttagaattg
gccactatattttgcgtcaacgaaaccgaagcggcccttatgacgcaagttgacagtatc
gttggtattaagcaagcagaagcagctatagctcgtctctttgagatgggtgccaatacg
gtaatcattaccttgggtaaattgggtgccgtctttgggcacaaagaaacgccaacgaaa
tttgaacatgttcctgccccacatgtacctccctgtaaagtagtagacactacgggcgct
ggtgatgccttcatcggtgctctggcccataacttagcaagatattcggaacgctcgctg
ggcgagcatattgccgctgccagtgccgtggcctcccaatcggttcaattgcctggaacc
caagctagttttccatatgccacgacgtcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system