KEGG   Drosophila willistoni: Dwil_GK25827Help
Entry
Dwil_GK25827      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K19603  
mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dwil_GK25827
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dwil_GK25827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 977 aa AA seqDB search
MASLAPNAHDRRIHELDENVEELFDVRKRLGKGAYGIVWKAVDKRQKETVALKKIFDAFR
DETDAQRTYREVIFLRAFRHHPNIIRMLDIYKAGNNLDFYLVFEFMESDLHNVIKKGDVL
KDIHKRFVMYQLINAIKYMHSGNVIHRDLKPSNILIDTKCRLKVADFGLARTLSTTKRGV
DYEKDDMENEVMLTDYVATRWYRAPEILVASRKYTKGIDMWSLGCILGEMIRQKPLFQGT
STVNQIEKIVNALPDVTPQDIESMGATFGSALLSKKIVRDRRYSLEEMLRNCCDDAMSLV
KSLLILDPDSRMTAKAAIVHPYVNRFRTASADMELRADVVPPLQDDIRYSVNEYRSNLYD
MILMESRNSRTSISARPNQTASGDGGDPPSNSQSGEVTPTPGPSSLQGPQRPPPPQAAHH
RSASQAPPGARDNSHVALRRELAAVVATAPRTSNGNSLWQQATLNNHTQHSRNHSNGHSN
GHSNGHSNGHSNGHSNGHSNGHSNGHSNGHSNGHTHGHGHGHGHGHGQGHIQGHGHGHTH
TTHHAHGHGHHGNQQQMATQNSTTWQPTTTTILPWPEHPISNSNPPPVEQQHDQHDMAIR
LRSRSLRKTSQDKAKLKPKLHPLPESQHSESEPKSTSLQQHVEHMLAVHTDKKKEARKAV
KKEEERSYEQKVNDLEASLKALQLQQQKKKIDLQKSRHQKKEHCDQHKERNERIESESHP
LPTESKPKESKKIRVVVTPKVAKAKDCPSQSKPQQQQSQPQPLQLPAGDGGSGECFYTPM
GTQRQRSSNSSNITIGTASATANAAAAAAYCYRTRILYLEAEMAKCKRQLVNYVEDNKEL
LSQPPLRYHIKQLQAEQDEDVEDEDEDGCGCPIDPENPLALHNTQAKSPQNDSGVEVEQS
GVGVNVNGGSGAGAGAGGDPSSSQSNYKTLKMQQHKQKQLQVKEFLTRDDVNAYELRPYK
TKVYHDFADHQRQHHHQ
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atggcttcattagcgccaaatgcccatgatcgacgtatccatgagttggacgaaaatgtt
gaagaactgtttgatgtgagaaagcgtttgggcaaaggagcctatggcattgtgtggaag
gcagttgataaacgtcaaaaggagacagttgcacttaagaaaatctttgatgcattccgt
gatgaaaccgatgcccaacgtacatatcgtgaggttatctttttacgtgctttccgccat
catccaaatatcatacgcatgttggatatttataaggctggcaacaatttggatttttat
ttagtgtttgagtttatggaaagcgatttgcataatgtgattaaaaagggtgatgtactt
aaggatatacacaaacgtttcgttatgtatcaattgattaatgccatcaaatatatgcat
tcgggaaatgttatacacagagatttgaagccaagtaatatattgattgatacaaaatgc
agacttaaagttgctgattttggattggctcgtacgctctccaccaccaagcgtggggtc
gactatgagaaagatgatatggaaaatgaggtcatgttgacagattatgtggccacacgt
tggtatcgtgcaccagaaattctagttgccagtcgcaaatacacaaaaggcattgatatg
tggagcttgggctgcatattgggcgaaatgatacgacagaagccactttttcagggcacc
agcactgtaaatcaaattgagaaaattgttaacgcattgcccgatgttacgccccaggat
attgaatcgatgggtgccactttcggttcggcattgcttagtaaaaaaattgtacgcgat
cgacgatattcgctggaggagatgttacgcaattgctgtgatgatgccatgtcattggtt
aaatctttacttatactcgatccagattcacgtatgacagccaaagcggcgatagtccat
ccgtatgtaaatcgttttcgcactgcctcagctgatatggaactgcgagcggatgttgtt
ccaccacttcaggatgatatacgctatagtgtgaatgaatatcgttcaaatctttatgat
atgatattgatggaatctcgaaattcacgtaccagtattagtgctcgtcccaatcaaacg
gcatctggcgatggtggtgatccaccgagcaattctcaatctggcgaggtgacaccaaca
ccaggaccatcatcattacaaggaccgcaaagaccgccaccaccacaagcggctcaccat
cgttcggccagtcaggcaccgcctggagctcgtgataatagccatgtggctttacgccgc
gaactggccgctgtggtggccacagcaccgcgtaccagcaatgggaatagcttgtggcag
caagcaacattgaataaccatactcaacatagccgcaatcatagtaatggtcatagtaat
ggtcatagtaatggtcatagtaatggtcatagtaatggtcatagtaatggtcatagtaat
ggtcatagtaatggtcatagtaatggtcatagtaatggtcatactcatggacatggacat
ggacatggtcatggtcatggtcaaggtcatattcagggacatggtcatggtcatacccat
acaacacatcatgctcatggtcatggtcatcatggtaatcaacagcaaatggcaacacag
aattctacgacgtggcagccaacaacaacaacgattttgccatggccggaacatccgata
tcaaattcgaatccgcctccagtggaacagcagcatgaccagcatgacatggccatacga
ctgagatcgcgttcgctacgcaagacttcccaggataaagcaaaattaaagcccaaactt
catccactacccgagagccagcattctgaatccgaaccgaagtcaacctcactgcaacag
catgttgaacatatgctggcagttcacacggataagaaaaaagaagccagaaaagctgtc
aaaaaggaagaggagcgttcttacgagcaaaaggtcaatgatttggaggcctccctaaag
gctctgcagctgcagcaacagaagaaaaagatcgatttgcagaaatcgagacaccagaaa
aaggaacattgtgaccaacataaggagcgtaacgaacgtatcgaatccgagtcccatcca
ttgccaacggagtcaaagccaaaagaatctaagaaaatacgagtggtggtcacaccaaag
gtggctaaagcaaaagattgtccatcccaatcgaaaccgcagcagcaacagtcgcagccg
cagccgctgcagctgccggcgggtgatgggggaagtggagaatgcttctacacacctatg
ggcacacagcgtcaaaggagcagcaacagcagcaacataaccattggcacagcctccgcc
acagccaatgcagctgcggccgctgcctattgctatagaacccgtatactttatctggag
gctgagatggccaaatgtaagcggcaattggttaactatgtggaggataataaggagctt
cttagtcaacctcccctacgctatcatatcaagcaattgcaagcagagcaggacgaggac
gtggaggatgaggacgaagatggttgtggatgtcccatagaccctgaaaatccattagct
ttacataatacacaagccaaatcgccgcaaaatgattccggtgtagaagtcgaacagagc
ggtgtcggtgtcaatgtcaatggcggaagtggagccggtgccggagccggaggtgacccc
agttcaagtcaatcaaattataagaccctaaagatgcaacagcataaacaaaagcaattg
caagtcaaagagtttctaacacgtgacgatgtcaatgcctacgagctacgcccatacaag
actaaagtctatcatgattttgctgatcatcagaggcagcaccaccaccag

DBGET integrated database retrieval system