KEGG   Drosophila yakuba: Dyak_GE10117Help
Entry
Dyak_GE10117      CDS       T01068                                 

Definition
GE10117 gene product from transcript GE10117-RA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dya  Drosophila yakuba
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dyak_GE10117
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dyak_GE10117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 280 aa AA seqDB search
MLKRKLNQQKDSLENGEPTKSFPRPGTTSDFFVEPLWLKFYETEVKLNEALDKLAPPAST
PFIYNPIVYASQLHRDYLRRYMDGPKKLVFVGMNPGPNGMGQTGIPFGNVRTVKVSMQLA
GPVDQPLVVHPKRTVAGLDCRTEEPSGVRLWELFLRLAGSMQIFSRQCFVHNFCPLAFFG
ADGKNITPSELSGPYKRQLGDLCLETLDEQLELLKPHVIVAVGEYVRSALKRSGYGKSHS
VPVLRLPHPSPRSTNNTNWPEKAQAFLEENNLIRFMRNEA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgcaaattgaatcagcagaaagacagtctggagaatggggagcccacgaag
tcttttcccaggccgggcactacatccgatttcttcgttgagccgctgtggctaaaattc
tatgaaaccgaagtcaagttaaatgaggcgctggataaattggctcctcctgcaagcact
ccgttcatctataacccgatagtgtatgcgtcccagctgcaccgcgactatttgcgtcgt
tatatggacggacccaaaaagctggtatttgttgggatgaatccgggacccaatggtatg
ggccaaaccggaattccttttggcaatgtgcgcaccgtaaaggtctcaatgcagctggca
ggaccggtggaccaacctcttgtcgtgcatcccaaacgtactgtcgctggcttggattgt
cgcactgaggagcctagtggtgtgcgtctgtgggaactgttcctccgattggctggcagc
atgcagatcttctcccggcaatgtttcgtccacaatttctgtccgctagcttttttcggc
gctgacggcaagaacataacacccagtgaacttagtggaccttacaaaaggcagctaggt
gacctgtgcttggaaaccttggacgaacaattggagcttcttaagccccacgtgattgtg
gctgtgggggagtacgttcggagtgcactgaagcgttcaggatacggcaaatctcattcc
gttccagtgctccgactgccgcatcctagtccgcggtccactaacaacaccaactggcca
gaaaaggctcaggcgtttttggaggagaacaacctaatcagattcatgcggaatgaggct
tga

DBGET integrated database retrieval system