KEGG   Drosophila yakuba: Dyak_GE10332Help
Entry
Dyak_GE10332      CDS       T01068                                 

Definition
GE10332 gene product from transcript GE10332-RA
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dyak_GE10332
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE10332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 364 aa AA seqDB search
MGANVSQLEREIGSDLFPPNEHYFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNK
RPKETLLSCLADLFYSIATQKKKVGSIAPKKFITRLRKEKEEFDNYMQQDAHEFLNFLIN
HINEIILAERNAGPSNGNPKASNQGGSTRNGTGSNGANSEPTWVHEIFQGILTSETRCLN
CETVSSKDENFFDLQVDVDQNTSITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRV
KKLPMILALHLKRFKYMEQFNRHIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIH
CGSGPNRGHYISIVKSHGLWLLFDDDMVDKIEASTIEDFYGLTSDIHKSSETGYILFYQS
RDCT
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccaatgtgtcgcagctggagcgggagattggctccgatctgttcccgccgaat
gagcactacttcgggctggtgaactttgggaacacctgctacagcaactcggtgctgcag
gccctctacttttgcaagccatttcgcgagaaggtcctcgagtacaaggccaagaacaag
cggcccaaggagacgctgctctcctgtctggcggatctattctacagcattgccacgcag
aagaagaaggtgggctccattgcgcccaagaagttcatcaccaggctgcgcaaggagaag
gaggagttcgataactatatgcagcaggatgcccatgagtttctcaatttcctgatcaat
cacatcaacgagatcatattggccgagcggaatgcaggacccagcaatgggaatccaaag
gcctcgaatcaaggcggaagcacaagaaatggaacaggaagcaatggggccaactcggag
cccacctgggtgcacgagatctttcagggcatactcacgtcggagacgagatgcctcaac
tgcgagacggtgagcagcaaggatgagaatttctttgacctccaggtggacgtggaccag
aacacctcgattacgcactgcctgcggtgcttcagcaacacggagaccctgtgctcggac
aacaagttcaagtgcgacaattgctgcagctaccaggaggcgcagaagaggatgcgggtg
aagaagttgcccatgatcctggccctgcatctcaagcgcttcaagtacatggagcagttc
aacaggcacatcaaggtctcgcatcgcgttgtcttcccactggaactacgactcttcaac
acctccgatgatgccgtgaatcccgatcgactctacgacctgaccgctgtggtcatccac
tgcggttccggaccgaatcgtggccattatatatcgattgtgaagagccacggactgtgg
ctgctattcgacgatgatatggtggacaaaatcgaggcttccaccatcgaggacttctac
ggcctgacctccgacatacacaagtcctcggaaacgggctacatactgttctatcagtcg
cgggactgcacctaa

DBGET integrated database retrieval system