KEGG   Drosophila yakuba: Dyak_GE10386Help
Entry
Dyak_GE10386      CDS       T01068                                 

Gene name
dyak_GLEANR_10315
Definition
(RefSeq) GE10386 gene product from transcript GE10386-RA (EC:3.2.1.45)
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dya  Drosophila yakuba
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dyak_GE10386 (dyak_GLEANR_10315)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dyak_GE10386 (dyak_GLEANR_10315)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dyak_GE10386 (dyak_GLEANR_10315)
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dyak_GE10386 (dyak_GLEANR_10315)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 564 aa AA seqDB search
MKTPSLGFLFALIAISAGANDDWQLPCDLRETSHGSVCVCNSTYCDYLEQPQLTDISQIV
VISSSKDGLRFKKTTGDISKGNPITIDDKPFTDENFKADAIVVDQERAWLQLANIPQSLF
INASIRAYRISVKREQRFQNVSIFGGAFTGTVSYLLKELPAELQDHVYRSYFHALGIGYN
TIRMSIGGSDFDMEPWAYNESPRNDLQLSNFTELDPRDLQKVEQLKRLKTIAKLGELKIM
GAAWSAPTWMKSNGRWTGFGQLKSEYYQTWALYHLKFLELMRAKNMPIWAISTGNEPLNG
VIGFFFVHFMSMGWTPWQQAIWLNDNLGPTIRNSAESKVLIFGNDDQRYTYPMWFRKMRS
SRSNSLSYLDGLAVHWYWDELIGPQLIDQAHTDMPNKLLLNTESCIGDKPWQTHGPELGS
WQRGESYMRAYTQDLTHHFNGWLDWNLVLDEQGGPNYVKNYVDAPIIVNATSRAEIYKQP
IFYAIGHFSKFLPPDSVRIETRIENQLNPFTQLSAVGFQRPDGSVALIIYNGQNLPVDVA
LDDSQRGVIQLRLPPRSWHTVLYK
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaccttcgcttggctttctttttgcactgatcgcaatctcagcaggtgccaac
gatgactggcagttgccctgcgatttgcgcgaaacgagccatggcagcgtgtgtgtctgc
aacagcacctactgcgactatctggagcagccgcagctcacggatatctcgcagattgtg
gtgattagctccagcaaggatggcctacgcttcaagaagacaacaggggatatttcgaag
ggaaaccccataacaatagatgacaaaccgttcaccgatgagaacttcaaggcagatgcg
attgtggtggatcaggagcgagcctggttgcagttggccaacattccccaaagcctgttt
ataaatgccagcattagggcatatcgcatatcggtgaaacgagagcagcgttttcaaaac
gtctccatttttggcggtgccttcacgggaacagtatcgtacttactcaaagaacttccc
gcagaactgcaggatcatgtctatagatcctatttccatgcgcttggaattggatacaac
accattcgaatgtccattggaggttccgactttgatatggagccgtgggcatataatgaa
tcgcctcgtaacgatctgcaattgagtaacttcaccgaactggatccgcgtgatctgcag
aaagtggagcagctgaaacgcctgaagacaattgccaaattgggtgaactgaagattatg
ggcgctgcgtggagtgcaccaacctggatgaagagcaatggacgctggacaggattcggg
caactgaaatcggaatattatcaaacgtgggcactctaccacctcaaatttctcgaactg
atgagggctaaaaatatgccgatttgggccatatccactggcaatgagccgttaaacggc
gtcattggcttcttttttgtacacttcatgagcatgggctggacgccctggcagcaggct
atctggctgaacgacaatctgggcccgaccatcaggaactcggcggagagcaaggtgctc
atctttggcaacgacgatcaacgctacacctatcccatgtggttccgaaagatgcgctcc
tcccgcagcaattcgctgtcatacttggatggcctagctgtgcactggtactgggatgag
ctgatcggtccacagctcattgaccaggcgcacacggatatgcccaacaagctgctcctg
aacacggagtcctgcatcggcgataagccatggcagacccatggtcccgagctgggcagt
tggcagcgtggtgagagctacatgagggcctatacccaggacctgacgcaccacttcaat
ggctggctggattggaatctcgtgttagatgaacagggtggcccgaattacgtcaagaac
tatgtggacgcaccgatcattgtgaatgccacgagtcgcgctgagatatacaaacagccc
atcttctatgccattggccacttctccaagttcctgccgccggattcagtgcgcatcgag
acgcgaatcgagaaccagctcaatcccttcacacagctgagtgccgtgggcttccagcga
ccagacggcagtgtggcgttgatcatctacaatggccagaatctgccggtggacgtggcc
ctcgatgatagccagcgtggagtgatccaactccggctgccgccgcgctcctggcacacg
gtgctctacaaatga

DBGET integrated database retrieval system