KEGG   Drosophila yakuba: Dyak_GE10413Help
Entry
Dyak_GE10413      CDS       T01068                                 

Gene name
Dyak_Pka-C1
Definition
GE10413 gene product from transcript GE10413-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dya  Drosophila yakuba
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dya04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:dya04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 488 aa AA seqDB search
MREEEEAALRNTKSILQFLKKKKSHHSSTSGEGKLQAQSSCEEEGGAAAGGAGAAAGPPA
DQASSSSSGPSSAAAAHKSTPPAATTTPGSGADSGGASGGAGGGGGGPSSSGDDQAQVSA
SATFRLSSLTGTISKMGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDD
FERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPF
LVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDL
IYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWW
ALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYG
NLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEK
CAKEFAEF
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggaagaggaagcagcgctgcgtaacactaagtccattttgcagttcctcaaa
aagaaaaagtcccatcatagttccacatccggcgagggcaagctacaggcgcagtccagt
tgcgaggaggagggcggagcggcagcgggaggagcgggagcggcagcgggacctccagcg
gaccaggctagcagcagcagcagcggcccctcgtcagcagccgccgcccacaagagtacg
ccccccgccgccacgaccacgcccggttcaggggcggattcaggaggtgccagcggagga
gcaggaggagggggaggaggacctagcagctccggcgacgatcaggcccaagtgtcggcc
agcgcaacgttccgtttgtcatcgctaacgggcaccatctccaagatgggcaacaacgcc
accacgtcgaacaagaaggtcgatgccgccgagacggtgaaggagttcctcgagcaggcc
aaggaggagttcgaggacaagtggcgacgcaatccgaccaacaccgccgccctcgatgac
ttcgaacgcatcaagaccctgggcactggctcctttggccgtgtcatgattgtccagcac
aagcccacgaaagactattatgccatgaagatcctcgataagcagaaggtggtcaagctg
aagcaggtggagcacacgctgaacgagaagcgaatcctgcaggccatccagtttcccttc
ctcgtctcgctgcgctaccatttcaaggacaactccaacctctacatggtgctggagtat
gtgcccggtggcgagatgttctcccatctgcgcaaggtgggccgcttctcggagccgcat
tcgcgcttctatgcggcgcaaatcgtgctggccttcgagtacctgcactacttggacctc
atctaccgtgatctgaagccggagaatctgctgattgactcgcagggctacctcaaggtg
acggacttcggttttgccaagcgggtcaagggccgcacctggacgctgtgcggcacgccc
gaatacctggccccggaaatcattctgtccaagggctataacaaggccgtcgactggtgg
gcgttgggcgtgctcgtctacgaaatggccgccggctatccgccgttctttgcggatcag
ccgatccagatctacgagaagatcgtatctggcaaggtgcgcttcccatctcactttggc
tccgatctgaaggacctgctgcgcaacctgctgcaggtggatctgaccaagcgctacggc
aatctgaaggcgggcgtcaatgatattaagaaccagaagtggttcgcctccaccgactgg
attgcgatcttccaaaagaaaatcgaggcgccgttcattccgcggtgtaagggtcccggc
gacacgagcaatttcgatgattacgaggaggaggcgctgcggatttccagcaccgagaag
tgtgccaaggagtttgctgaattctag

DBGET integrated database retrieval system