KEGG   Drosophila yakuba: Dyak_GE10479Help
Entry
Dyak_GE10479      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dya  Drosophila yakuba
Pathway
dya00062  Fatty acid elongation
dya00071  Fatty acid degradation
dya00280  Valine, leucine and isoleucine degradation
dya00310  Lysine degradation
dya00380  Tryptophan metabolism
dya00410  beta-Alanine metabolism
dya00640  Propanoate metabolism
dya00650  Butanoate metabolism
dya01040  Biosynthesis of unsaturated fatty acids
dya01100  Metabolic pathways
dya01200  Carbon metabolism
dya01212  Fatty acid metabolism
Module
dya_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
dya_M00085  Fatty acid biosynthesis, elongation, mitochondria
dya_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dyak_GE10479
   00650 Butanoate metabolism
    Dyak_GE10479
  Lipid metabolism
   00062 Fatty acid elongation
    Dyak_GE10479
   00071 Fatty acid degradation
    Dyak_GE10479
   01040 Biosynthesis of unsaturated fatty acids
    Dyak_GE10479
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dyak_GE10479
   00310 Lysine degradation
    Dyak_GE10479
   00380 Tryptophan metabolism
    Dyak_GE10479
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dyak_GE10479
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     Dyak_GE10479
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dyak_GE10479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 6527872
NCBI-ProteinID: XP_002088944
FlyBase: FBpp0255489 FBgn0228340
UniProt: B4NY54
Position
2L
AA seq 783 aa AA seqDB search
MSATRFLSAVGQISRQQLLQNKCTRALPISAQLLQSRRLMSTNPAPVANKHLHTKVVNGV
LVIKFDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGMLEA
CQTPAEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKL
GLPEVMLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGL
QPAEQNTIEYLEKTAVQVANDLASGKLRVNREKSGLVNKIQSFVMDTDFVKNKIFDTARK
QVLKASNGLYPAPLKILDVIRAGVDKGSEAGYEAERKGFGELSATPESKGLIALFRGQTE
CKKNRFGKPERPVKTVGVLGAGLMGAGIVQVSVDKGYQVVMKDATDAGLARGIGQVQKGL
ETAVKRKRISGLERDQTLANLRPTLDYSDFKNADIIIEAVFEDINVKHRVIKELEAVVPE
HCVIATNTSAIPITKIAAGSSRPEKVVGMHYFSPVDKMQLLEIITHPGTSKDTVAQAVAV
GLKQGKVVITVGDGPGFYTTRILSTLLSEAIRLLQEGVDPKDLDQYTKKFGFPVGAATLA
DEVGIDVGSHIAVDLAKAFGERFSGGNLEVMNDLVLAGFLGRKSGKGIFLYDGQKRGTRP
VNNDAVEIVKQKYALVSKGANTPEDLTLRMVSRFINEAVLCLEEKILDSPLEGDVGAVFG
LGFPPFSGGPFRWVDQYGAGKLVSKMQSYAELYGAPFKPAQTLLDMAKDPAKKFYPKTGS
SKL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaacgagatttctgagtgccgttggccaaatttcgcgacagcaattgctgcag
aataagtgcacaagagccctgcccatttcggcgcagctcctccagagtcgccgcctaatg
tccacgaatcccgcaccggtggccaacaagcatctgcacaccaaggtggtcaatggcgtg
ctcgtgatcaagttcgattcgcccaatgccaaggtgaattccctgggctccgaggtgagc
gatgagttcgagcgagtgatcaaggatctggaaacgaatcctgcggtgaactccgccgtg
ctcatttcgggcaaaccgggctgctttgtggccggtgctgatatcgggatgctggaagcg
tgccagacgccggcggaggccacgttgatctcgcacggcgcccaggtgatgttcgatcgc
atggagcgcagcaagaagcccattgtggccgccatcagcggtgtctgtctgggtggcggt
ctggaactcgcccttgcctgccattaccgcattgccaccaaggacagcaagaccaaactg
ggtctgcccgaggtcatgctgggtctcctgcccggcggcggtggcaccgtgcgcctgccc
aagcttacctccgtgcccacagctctggatatggagctgaccggcaaacaggtgcgcgcc
gatcgcgcaaagcgactgggcattgtggatctgctggtggatcccctaggtcctggactc
cagcctgctgaacagaacaccatcgagtacctggagaagactgctgtgcaggtggccaac
gatttggccagtggcaaacttcgcgttaatcgcgagaagagcggtctggtcaacaagatc
cagtccttcgtcatggacactgactttgtaaagaacaagatcttcgacactgccaggaag
caggtgctcaaggcctcgaatggcctctatcccgctcccctgaagattcttgatgtgatc
cgtgctggcgtggataagggatccgaagcaggttacgaggcggaacgcaagggttttggc
gagctgtcggccacgcctgagtccaagggcttgattgccctgttccgtggacaaacggag
tgcaagaagaaccgatttggcaagcccgagcgtccggttaagactgtgggagttctggga
gctggtctgatgggagccggaattgtacaggtctccgtcgataagggataccaggtggtg
atgaaggatgctaccgatgccggtctggctcgtggtattggacaggtgcagaagggcttg
gagacggctgtcaagcgcaagcgaatctctggactggagcgtgatcagactcttgccaac
ctgcgccccactcttgattacagcgacttcaagaacgcagacatcatcatcgaagctgtg
ttcgaggacatcaatgttaagcaccgtgttatcaaggagttggaagcagtggttcccgag
cactgcgtcattgccaccaacaccagcgccattcccatcaccaagatcgcagcaggaagc
tcgcgtcccgagaaggtggtcggcatgcactacttctcgcccgtggacaagatgcagctg
ctggaaatcatcacacacccaggcacctccaaggacacggtcgctcaggctgtggcagtc
ggtctcaagcaaggcaaggtcgtgatcactgttggtgacggacctggcttctataccacc
cgcatcctctccaccctgctgtcggaagccataagactgctgcaggagggcgtggacccc
aaggatctggaccaatacacgaagaagtttggtttccccgtgggtgctgcgacccttgct
gatgaggttggcatcgacgtgggttcccacattgccgttgacttggcgaaggcattcggc
gaacgcttcagcggtggaaacttggaggtgatgaatgatctggtcctggctggttttctc
ggtcgcaagtccggcaagggcattttcctgtacgatggccagaagaggggcactcgtcca
gtgaacaacgatgccgtcgagatcgtcaagcagaagtacgcgttagtctcaaagggtgcc
aatacccccgaggatctgacgctgcgcatggtgtcccgcttcatcaacgaagctgtgctg
tgtctggaggagaagattctggacagcccgctggagggcgatgtcggagccgtatttggc
ctgggcttcccgccattctctggtggtcccttccggtgggtggatcagtatggagcaggc
aaactggtcagcaagatgcaatcctatgctgagctgtacggagcacccttcaagcctgca
cagactctgctcgacatggctaaggacccggcgaagaagttctaccccaagactggctcc
tcgaagttgtag

DBGET integrated database retrieval system