KEGG   Drosophila yakuba: Dyak_GE10483Help
Entry
Dyak_GE10483      CDS       T01068                                 

Definition
GE10483 gene product from transcript GE10483-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dya  Drosophila yakuba
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dyak_GE10483
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dyak_GE10483
Translation factors [BR:dya03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dyak_GE10483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 212 aa AA seqDB search
MESSKQTKEFLKSKKGSPLDKDSPPGVARKHKLQNTWTLWRVDHDPKKSWEDILYEVGSF
NTVEDFWIQYYSTDPPSKLKIDCDYMLFKKGIRPMWEDLPNKHGGRWTYIVHKEAKSELD
TIWLDVLLCLIGEACDHCDQICGALVRIRKSISKVSVWTKNCEDNEANMEIGQKLCELVS
VSSKKIITFKSHRQLKPQLKRTPPIFVLKAEP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggagagctcaaagcaaaccaaagaatttttaaaatcgaaaaaggggagtcccctggat
aaggatagtccgccaggtgtggcaaggaaacacaagcttcagaacacatggaccctgtgg
cgcgtggatcacgaccccaaaaaatcgtgggaggatattctgtacgaggtcggtagcttc
aacaccgtcgaggacttctggattcagtattacagcaccgatccgccatccaagcttaaa
atcgactgtgattacatgctcttcaagaagggcattcgccccatgtgggaggatctgccg
aacaagcacggcggtcgttggacatacattgtgcacaaggaggctaaatccgaactggac
accatttggctggacgtacttctttgcctgattggcgaggcctgcgatcattgcgatcag
atatgtggggctttggtcaggattcgcaagtcaatcagcaaagtctccgtctggacaaag
aactgtgaggacaacgaggcaaacatggagattggtcaaaaactctgtgagctcgtaagc
gtcagcagcaaaaaaattataacatttaaatcgcatcgtcaactgaaaccacaattgaaa
cgaacgcctcctatttttgtgttgaaggctgaaccttga

DBGET integrated database retrieval system