KEGG   Drosophila yakuba: Dyak_GE10483Help
Entry
Dyak_GE10483      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03259  translation initiation factor 4E
Organism
dya  Drosophila yakuba
Pathway
dya03013  RNA transport
dya04150  mTOR signaling pathway
Module
dya_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dyak_GE10483
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dyak_GE10483
Messenger RNA biogenesis [BR:dya03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dyak_GE10483
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dyak_GE10483
Translation factors [BR:dya03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dyak_GE10483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 6538113
NCBI-ProteinID: XP_002098648
FlyBase: FBpp0255493 FBgn0228343
UniProt: B4PQM1
Position
3R
AA seq 212 aa AA seqDB search
MESSKQTKEFLKSKKGSPLDKDSPPGVARKHKLQNTWTLWRVDHDPKKSWEDILYEVGSF
NTVEDFWIQYYSTDPPSKLKIDCDYMLFKKGIRPMWEDLPNKHGGRWTYIVHKEAKSELD
TIWLDVLLCLIGEACDHCDQICGALVRIRKSISKVSVWTKNCEDNEANMEIGQKLCELVS
VSSKKIITFKSHRQLKPQLKRTPPIFVLKAEP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggagagctcaaagcaaaccaaagaatttttaaaatcgaaaaaggggagtcccctggat
aaggatagtccgccaggtgtggcaaggaaacacaagcttcagaacacatggaccctgtgg
cgcgtggatcacgaccccaaaaaatcgtgggaggatattctgtacgaggtcggtagcttc
aacaccgtcgaggacttctggattcagtattacagcaccgatccgccatccaagcttaaa
atcgactgtgattacatgctcttcaagaagggcattcgccccatgtgggaggatctgccg
aacaagcacggcggtcgttggacatacattgtgcacaaggaggctaaatccgaactggac
accatttggctggacgtacttctttgcctgattggcgaggcctgcgatcattgcgatcag
atatgtggggctttggtcaggattcgcaagtcaatcagcaaagtctccgtctggacaaag
aactgtgaggacaacgaggcaaacatggagattggtcaaaaactctgtgagctcgtaagc
gtcagcagcaaaaaaattataacatttaaatcgcatcgtcaactgaaaccacaattgaaa
cgaacgcctcctatttttgtgttgaaggctgaaccttga

DBGET integrated database retrieval system