KEGG   Drosophila yakuba: Dyak_GE10528Help
Entry
Dyak_GE10528      CDS       T01068                                 

Definition
GE10528 gene product from transcript GE10528-RA
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
dya  Drosophila yakuba
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dya00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 1441 aa AA seqDB search
MKLSTDAHSEIEGDGAHGNVLSNSASDSLAATDEVAAGNDESVATEGDDVEIPKDATNST
PVRRLVKPHPGQNSEQPAGDESELENQRRTPIQKQQQQRLSMVNRKRDLINLQSALSPKY
IGYANANSPTPLSDSDDTIRTTRRRVNQAAALNNSSSAAETLSRDNASPRTTGGGGGGGG
GGSANQLLSKTYMSPIEKLLIKNGASSPNSTGFEADSEDLAIRPTVRKQLKRKMKRMSKS
KVSLDLEPEKLDEEKPVKTEPLDIGEVDLAEEAPNQEVETPEISIKPETEAENEAAVEDV
HIKQEDATSLDIVSNIVETTPIVVAEEPKELEKSTKELTFALPLAASTEVDLKSPPDLSS
SALATSIKSPSSVSIDSAKGLSIVTDPGWPTYQVGDLFWGKVFSYCFWPCMVCPDPLGQI
VGNMPSHPQRSSLDNAIVPIQVHVRFFADNGRRNWIKPENLLTFAGLKVFEDQREEVRIK
NGPKSAKYRQMVPKRTKVLIWRQAIEEAQVMAEIPYSDRLEKFYQIYENAVTLNRQKRNR
TKSMMQDTSDVGSSLYDSTDNLHNKQATHLLAVKRERSESPFSPAFSPLKSKNEKRAKRR
KLSNGTEADTGSISMAVTPSQTETTLEKTHSPDGSIYENPEFRQLFDAVKEYVMVHRSEE
KVEKVLLAVVSNIWSLKQIQLRELERDLASGEMEEPLGSSVVGRGNGVGTIKRLSNRLKT
MMVRRSMTPVVTPSTTPAPSEPDRRLAEAPKPKKPVNRPIEEVVEDILQLDSKYLFRGLG
RDPICKYCYQAGTDLVRCSRSCSSWLHADCLERKETGAPMPKIGSRKALVITPTSKSPSP
DEEHVTADGKVAAGGTSLVCHECNVGEPEGCVICHQVESPAVPSTPMKEEAPSHIPIEDK
LLTCSQPLCGKRFHTSCCKYWPQANSSKHSARCPRHVCHTCVSDDPSGKFQQLGSSKLAK
CVRCPATYHQDSHCIPAGTQMLNATHIICPRHNIAKADAHVNVLWCYICVKGGELVCCET
CPIAVHAHCRNIPIKTNENYICEECESGRLPLYGEIVWAKFNNFRWWPAIILPPTEVPSN
ILKKAHGENDFVVRFFGTHDHGWISRRRVYLYIEGDTGDGHKTKSQLFRNYTTGVEEASR
FLKIIKARRQEQAIGRQSGNKLHPPPYVKIKTNKAVPPVRFTQNLEDLSACYCQPGDDHP
CGPDSGCINRMLFNECNPEFCKAGNRCENQMFEQRKSPRLEVVYMNERGFGLVNREPIAE
GDFVIEYVGEVINHAEFQRRMEQKQRDRDENYYFLGVEKDFIIDAGPKGNLARFMNHSCE
PNCETQKWTVNCIHRVGLFAIKDIPVNTELTFNYLWDDLMNNSKKACFCGATRCSGEIGG
KLKDGAVKESNAQTAKGKASAKLKQIRRGKASAVRIHVKAKKAPKVKHISADDEPMEVKN
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgagcacggacgcgcactccgagatcgagggcgatggtgcccacggcaatgtg
ctgtccaattccgcgtccgattccctggccgccaccgacgaagtggctgcgggcaacgac
gagtcggtggccaccgaaggcgacgatgttgaaattccaaaggacgccaccaacagtacg
cctgtacggcggctggtcaagccgcatcccggccagaatagtgagcagcctgcgggagat
gagtccgagctggagaatcagcggcggacgccaatccaaaaacagcaacaacagcgtctc
tccatggtgaacaggaaacgagatcttatcaacttgcagtcggccctgagccccaaatat
attggttatgccaatgccaactcacccacgccgctatccgattctgatgacacgatacga
acgacgaggcggcgcgttaaccaagcagcggctctgaataacagcagtagtgccgccgag
accctgtcccgtgacaatgcctcaccaaggaccaccgggggaggaggaggaggtggtgga
ggcggtagcgctaatcagctgcttagcaaaacctatatgagtcccattgagaagctgcta
atcaagaacggcgccagttcgcccaacagcaccggcttcgaggcggactccgaggatctg
gccatacggccaaccgtgcgcaagcagctcaagcgcaaaatgaagagaatgtccaagtcg
aaagtgtcccttgacctggagccggaaaagctggatgaagaaaagccagtgaaaacggag
ccactagatataggggaagttgacctggcggaagaagcccctaatcaagaggttgaaact
cccgagatctccatcaaaccagagactgaggctgagaatgaagcagccgtagaagatgtt
catataaagcaagaggatgctaccagtttagatattgttagcaatatagtagagaccacg
cccatagttgtcgctgaagagccgaaagaactggaaaaaagtactaaagaattgacattt
gccctgccattggccgcctccacagaggtggatctgaaatctcccccggacttgagctct
tcagcgcttgccacctccatcaaatccccctcctccgtgagcatcgatagcgccaaaggc
ctgtccatagtaactgatcccggttggcccacctaccaagttggtgatctgttttggggc
aaggtcttctcgtactgcttctggccctgcatggtgtgtccggatccgcttggccagatt
gtgggcaacatgcctagccatcctcagcgctcatcccttgacaacgccatcgttcccatt
caagtgcatgtgcgcttcttcgctgacaacggacgtcgcaactggattaagccggagaat
ctgctaacctttgccggactgaaggttttcgaggatcagcgcgaggaagtgcgaataaag
aatggaccgaagagcgccaagtaccgtcagatggtgcccaagcggacaaaagttctcatc
tggcgtcaggccatagaagaggcgcaagttatggccgagattccgtactccgaccgcctc
gaaaaattctaccagatctacgaaaacgcggttactctaaatagacaaaaacgcaaccga
accaagtcaatgatgcaagacacttccgacgtgggcagcagcctgtacgactccacggac
aacctgcacaacaagcaagccacacatttgttggccgtgaagcgagaacgctcagagtcg
ccctttagcccggctttctcgcccttaaagagcaaaaacgagaagcgggccaagcgccga
aaactgagcaatggcaccgaagcggatactggcagcatcagcatggcagtaactccttcc
cagaccgaaaccactttggaaaagacccactcgcctgacggctccatttacgagaatccc
gagttcagacaactcttcgatgccgtcaaggaatacgtaatggtgcaccgttccgaggaa
aaagtggagaaggttctgctcgccgtggttagcaatatctggtctctgaagcaaatccaa
ttgcgcgagctggaacgcgacttggccagcggcgaaatggaggagccgttaggctcatcg
gtagtgggtcgtggcaatggagttggcacaatcaaacggctctcgaatcggctgaaaacc
atgatggtgcgccgtagcatgaccccagtggtgactccgagtacaacgccagcaccatcg
gagccagatcgtcgcctggcggaagcgccgaagcccaagaagcccgtcaaccggcccatc
gaagaagtggttgaggacatcttgcagctggacagcaagtacctcttccgtggactgggc
cgtgatcccatatgcaaatattgttaccaggcgggaaccgatctagtgcgctgttcgcgc
agctgctcgagctggctgcatgccgactgcctggaacgaaaggagacaggagctccgatg
cccaaaataggcagtcgaaaggccttggtcattacacccacatcgaaatctcccagtccc
gatgaggagcatgtcacagccgacggcaaagtggctgccggtggtacttcactggtttgt
catgagtgcaatgtgggcgaaccggaaggctgtgtcatttgccatcaagttgaatcacca
gctgtaccaagcactcccatgaaggaggaggcaccgtctcacatcccaatcgaagataag
ctcctgacatgcagccagccactgtgtggcaagcggtttcacacgagttgctgcaaatat
tggccgcaggcgaacagcagcaaacactcagcccgttgcccgcgacacgtgtgccacaca
tgcgtctctgacgatcccagcggcaagttccagcagctgggcagctccaaactggccaaa
tgcgttcgctgcccggccacctatcaccaggactcacattgcattccagccggcacccaa
atgctgaatgctacccacataatctgtccgcggcacaacatcgccaaggcggatgctcac
gtcaacgttttgtggtgctacatctgcgttaaaggcggcgaactggtatgttgcgaaaca
tgccccattgctgtgcacgcccactgccggaatattccgatcaagaccaacgagaactac
atctgcgaggagtgtgagagcggtcgccttccgctttacggtgaaatcgtgtgggcgaag
ttcaacaacttccgctggtggccggccatcatcctgccgcccaccgaggtgcccagcaac
atactaaagaaggcccacggcgagaatgactttgtggtgcgattctttggcacgcacgat
catggctggatttcgaggcgccgcgtatacctttacatcgagggggatacgggcgatggc
cacaagaccaagtcgcagctgtttcggaactacaccaccggcgtggaagaggcgtcgcgc
ttcctcaaaatcatcaaagcccgccggcaggaacaggccattggacggcagagcggtaat
aagctccatccgcctccatatgtgaaaatcaaaaccaacaaggcggtgccgccggtgcga
ttcacacagaatctagaggatttgagtgcttgttactgccagccgggcgacgatcatccc
tgtggcccggactccggttgcattaaccgcatgctgttcaatgaatgcaatccggaattc
tgcaaggcgggcaatcgttgcgagaatcaaatgtttgagcagcgcaagtcgccacgtctg
gaggtggtctacatgaacgagcggggattcggactcgtcaaccgtgagcccattgccgag
ggtgactttgtcatcgagtacgtgggcgaggtgatcaaccatgccgaattccagcgacgc
atggagcagaagcagcgggatcgggacgagaactactacttcctgggcgtggaaaaggac
tttattatcgatgcgggaccaaagggcaacttggctcggttcatgaaccattcttgcgag
cccaactgcgaaacccaaaagtggaccgtcaactgcatccatcgtgtgggcttatttgcc
atcaaagacattccagtgaacacggagctcaccttcaactacttgtgggacgacctaatg
aacaacagcaagaaggcctgtttctgcggagcaacgcgctgttccggtgaaatcggtggc
aaactcaaggatggcgcggttaaggaatcgaatgcgcagacagccaagggaaaggccagt
gcaaagctgaagcagatacggcggggaaaagcatccgccgtgcgcatccacgtaaaggct
aagaaggctcccaaggttaaacacataagtgcggacgatgagccaatggaggtgaagaat
gagtaa

DBGET integrated database retrieval system