KEGG   Drosophila yakuba: Dyak_GE10618Help
Entry
Dyak_GE10618      CDS       T01068                                 

Definition
GE10618 gene product from transcript GE10618-RA
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     Dyak_GE10618
Peptidases [BR:dya01002]
 Serine Peptidases
  Family S8: subtilisin family
   Dyak_GE10618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 654 aa AA seqDB search
MAAATCSWLLAPFLLLHWATAGAGGGAGGLGAGLSGPSVFTSSFLVRFRRGVDNAFAHDV
ADKYGFDNLGPLVGADGHEYHFKHRTLPHARTRRSLTHTRALKSHPAVHTAVQQPGFKRV
KRGLRPAVPAIHGMKFDLKVGEANRIDEEPTDPYFPMQWYLKNTGQNGGKVRLDLNVQAA
WAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTR
CAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGP
TDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISI
NSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAG
VFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAG
AMVTLSKQWHAVPPRYHCEAGELTQPQAIVMGRSLFWEIKTDACKGSDTEVNYLEHVQAV
ISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKL
EARFNSPQTRHGNLLEWSLVLHGTKEAPYRTLHPSSPHSKLAIVKKAHEDKKMK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagccacatgtagctggctgttggccccattcctgctcctccactgggccact
gcaggagcgggcggcggagcaggcggattgggagcgggactgagcggcccctccgtattc
accagctccttcctggtgcgcttccggcgcggagtggacaacgcgtttgcccatgatgtg
gccgacaagtacggcttcgacaacctaggcccgctggtcggcgccgatggacacgagtat
catttcaagcaccggacccttccacatgcccgcaccaggcgaagtctgacgcacacacgg
gcccttaagagccatccggcggtgcatacggccgtgcaacagccgggtttcaagcgggtt
aaacgaggcctgcgaccggcggtgcccgccattcacggcatgaagttcgacctgaaagtg
ggcgaggccaatcggattgacgaggagcccactgacccctactttcccatgcagtggtac
ctcaagaacacgggccagaatggcggcaaagtcaggctggatctgaatgtacaggctgca
tgggcgcagggcatcaccggaaagaatgttacgactgccatcatggatgatggcgtggac
tacatgcatccggatctgaaattcaattataatgccgaggccagttatgacttcagcagt
aacgatccctttccatatccccgatacaccgacgactggttcaacagccatggaactcgt
tgtgccggcgaagtggctgctgccagagataatggaatttgcggcgttggcgttgcttat
gacagcaaaatcgcaggcattcgcatgctggatcagccgtacatgacggacctaatcgag
gccaactccatgggccacgagccgcacaaaatccacatctacagcgcctcctggggtccc
accgatgatggcaagaccgtggatggtccccggaatgccaccatgcgcgcgatagtccag
ggcgtcaatgagggacgaaatggcctgggcaacatctatgtttgggcatccggcgacggc
ggcgaggaggatgactgcaactgcgacggctacgccgcctccatgtggaccatatccatt
aacagtgccattaacgatggccagaacgcccactacgacgagagctgcagctccacgctg
gcgtccacattcagcaacggagccaaggaccccaacacgggcgttgccaccacggacctc
tatggcaagtgcacgaccacccactcgggcaccagtgcggcggcgcccgaagcagcgggc
gtctttgccctggccttggaggccaatccgcagctgacttggcgggacatacagcatctg
acggtgctgacatcgaagcgcaactcgctgttcgatgccaagaaccgattccactggaca
atgaacggcgtgggcctggagttcaatcacctattcgggttcggagtgctggacgccggc
gccatggtcacactatccaagcagtggcatgcagtgccaccacgctatcattgcgaggcg
ggcgagctcacccagccgcaagccattgttatgggtcgttcgctcttctgggagatcaaa
acggatgcctgcaagggcagcgacacggaggtcaactatttggaacatgtacaggcagtg
atctcggcaaatgcctcacgacgcggcgatctggagctcttccttacatcgccaatgggc
actaaatccatgatcctgtcgaggcgcgccaacgacgatgaccaccgcgatggcttcacc
aaatggcccttcatgaccactcactcgtggggcgagtatccgcagggaacctggaaactg
gaggctcgcttcaattcgccacaaacgcgacatggcaatctgctggagtggtccttggta
ctacatggcaccaaggaggcgccctaccgcaccctgcatccctcgtcgccgcactccaag
ctggccattgtgaagaaggcgcacgaggacaagaagatgaagtag

DBGET integrated database retrieval system