KEGG   Drosophila yakuba: Dyak_GE10688Help
Entry
Dyak_GE10688      CDS       T01068                                 

Gene name
dyak_GLEANR_10590
Definition
(RefSeq) GE10688 gene product from transcript GE10688-RA (EC:3.1.1.- 3.1.1.1)
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dya  Drosophila yakuba
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dyak_GE10688 (dyak_GLEANR_10590)
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dyak_GE10688 (dyak_GLEANR_10590)
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dyak_GE10688 (dyak_GLEANR_10590)
  Exosomal proteins of breast milk
   Dyak_GE10688 (dyak_GLEANR_10590)
Glycosaminoglycan binding proteins [BR:dya00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   Dyak_GE10688 (dyak_GLEANR_10590)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dya00537]
 Enzymes
  Dyak_GE10688 (dyak_GLEANR_10590)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 480 aa AA seqDB search
MTMAMSMAMDMAKTNRRPAVQVKVANEVESALRMGTMMMRMRNRGGERWQTNYFDTQMPL
LSSGLMSPGLLPILNEQSVHHGQSGQQEPSKRHYLAHGPSSVEQQLLRLQPDYKLLYSAE
HHTYFHLHTQIPQDNASRQTGASKHRTSEKASPNRRLFQQVVGNTLTAAFGLNVMNKGQD
QEQSQQFTSEPVQLYDAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFGLRNG
NYNIFTVDWGRGAIADYITASYRVKPVGQIVAKFVDFLHQEAGMRFEDLQLIGFSMGAHV
AGLAGKHVQTGRLRMIRALDPALPFFRYAKPKERLTPEDADYVEVLHTSVGSYGFDRPVG
HVDFYANWGSQQPGCFWHECSHWRAFMLFAESLAGDQETGFLSQGCPAAEWQQLTRFQRC
PKDTGVLQTMGGDLANVTAEFLAQRQGVYYFQTNDQPPYVLAQNASTHMEKINSEMAERT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgactatggcgatgagtatggcgatggatatggcgaagacgaatcgaagacccgcagtg
caagtaaaagtggcaaatgaagtggaaagtgccctcagaatgggaacaatgatgatgcgg
atgagaaatcggggcggtgagcggtggcagacgaactactttgacacacaaatgccactg
ctgtcgtctggcctaatgagtcccggcctgctgccaatattgaatgaacagtcggtgcat
catgggcagtctggacagcaggagccgtcaaagaggcattacttggcccacgggcccagt
tcggttgaacagcaattactccgcctgcagccggactacaaattgctgtacagcgccgag
caccacacctatttccatctacacacccagatcccgcaggacaatgccagtcgccagaca
ggagcatcgaaacataggacatcggagaaggcatcgccaaatcgcaggctattccagcag
gttgtgggcaacacgctgaccgccgcctttggcctgaatgtgatgaacaagggccaggac
caggagcagagccagcagttcaccagcgaaccggtgcagctctacgatgccgcctcgttg
cgtcggtctcgcttcagtcccttcaatcccaccagaatcctcattcacggctggctgggc
aatgagaatgccaacatgtacaacgaactgttgccagcttattttgggctcagaaatggc
aactacaacatcttcaccgtggactggggacgtggtgccatagcggactatataacggcc
agttatagggtcaagccggtgggtcagattgtggccaagttcgtggactttctgcatcag
gaggcgggtatgcgtttcgaggatctccagctcatcggattcagcatgggtgcacatgtg
gctggactagctggaaagcatgtgcagaccggtcgcctacggatgatccgagctttggat
ccggcactgcccttcttccggtatgccaagccaaaggagcgactgaccccggaggatgcc
gactatgtggaggtgctgcacaccagtgtgggcagctatggatttgatcgacctgtgggt
catgtggatttctatgccaactggggcagccagcagccaggttgcttttggcatgaatgc
agccattggagggcatttatgctgtttgccgagagtctcgctggggatcaggagacgggc
ttcttatcccagggctgtccagctgctgaatggcagcagttgacccgattccaacgctgc
ccaaaggacaccggagtcctgcagaccatgggcggggatttggccaatgtgacggcggag
ttcttggcccaaagacagggtgtctattattttcaaacaaacgaccagccaccctatgtt
ttagcacaaaatgccagcacacatatggaaaaaataaatagcgaaatggctgagagaacg
taa

DBGET integrated database retrieval system