KEGG   Drosophila yakuba: Dyak_GE10709Help
Entry
Dyak_GE10709      CDS       T01068                                 

Definition
GE10709 gene product from transcript GE10709-RA
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dya  Drosophila yakuba
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    Dyak_GE10709
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     Dyak_GE10709
Glycosyltransferases [BR:dya01003]
 Glycan extension
  Type 3 chain
   Dyak_GE10709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 388 aa AA seqDB search
MTANSLLGRSILNEGRSNKRSFVSLIVGLIVGFCLAELFVYSTPERSEFMPYDGHRHGDV
NDAHHSHDMMEMSGPEQDVGGHEHVHENSTIAERLYSEVRVLCWIMTNPSNHQKKARHVK
RTWGKRCNKLIFMSSAKDDELDAVALPVGEGRNNLWGKTKEAYKYIYEHHINDADWFLKA
DDDTYTIVENMRYMLYPYNPETPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEAL
PNPKLCKADNSGAEDVEIGKCLQNVNVLAGDSRDSNGRGRFFPFVPEHHLIPSHTDKKFW
YWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPYGIINTPEALPNKLAVG
ELMPEIKEQVTESSSDGVSKRSAETKTQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaacagtttgctgggaaggtccatactcaatgaaggacgctcaaacaagcgc
tcatttgtgtccctcatcgtgggtctgatcgtgggcttctgcctggcggagctgtttgtc
tactccacgccggagcggagtgagtttatgccatacgatggccatcggcacggcgacgtg
aacgatgcccatcacagccacgacatgatggagatgtccgggccggaacaggacgtgggt
ggacacgagcacgtgcacgagaactcgaccattgcggagcgactgtatagcgaggtgcgg
gtgctctgctggatcatgactaatccgagcaatcatcagaagaaggcgcgccacgtgaag
cgcacctggggcaagcggtgcaacaagctgatcttcatgagctccgccaaggacgacgag
ctggacgcagtggctctgcccgtgggcgagggtcgcaacaacctgtggggcaagacgaaa
gaggcgtacaagtacatctacgagcaccacatcaacgacgccgactggttcctcaaggcg
gacgatgacacgtacacgatagtggagaacatgcggtacatgctgtatccgtacaatccg
gaaactccagtctacttcggctgcaagttcaagccgtacgtgaaacaaggctacatgtcc
ggcggtgccggatacgtcctcagccgagaggctgtgcgtcgctttgtggtcgaagccctg
cccaatccgaagctgtgcaaggcggacaactcgggtgccgaggacgtcgagattggcaag
tgcctgcagaatgtaaacgtgctcgctggggactcgcgagactcaaatggtcggggtcgc
ttctttccatttgttccggagcaccatttgattccatcgcacacggacaagaagttctgg
tactggcagtacatcttctacaagacggatgagggtctcgactgctgctcggacaatgcc
atatccttccactacgtctctcccaatcaaatgtatgtgctggactatctgatctaccat
ctgagaccgtacggcatcataaacacacccgaagcattgcccaataagctggccgtgggc
gaactgatgccggagattaaggagcaagtgacggaaagttcgagtgatggggtctccaag
agatccgccgagacaaagacgcaataa

DBGET integrated database retrieval system