KEGG   Drosophila yakuba: Dyak_GE10768Help
Entry
Dyak_GE10768      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11418  histone deacetylase 11 [EC:3.5.1.98]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dyak_GE10768
Chromosome and associated proteins [BR:dya03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     Dyak_GE10768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl DUF1256
Motif
Other DBs
NCBI-GeneID: 6538648
NCBI-ProteinID: XP_002099168
FlyBase: FBpp0255778 FBgn0228610
UniProt: B4PV31
Position
3R
AA seq 343 aa AA seqDB search
MKRLTERVHHEEQESEEVVWVKREDARIAGKLPIVFSRNYAVRFGGLERLHPFDAAKGKH
IHKLLCAQLQLDEGSFYEPTELTKNQLRRIHTRGYLKSLRWSMNVACIAEVPVMAFVPNR
YIQRSYLRPMRFQAAGSILAGRLALDYGWAINLGGGFHHCCSYRGGGFCPYADISLLIVR
LFEQEPYRVRRIMIVDLDAHQGNGHERDFNNVAAVYILDMYNAFVYPRDHVAKESIRCAV
ELRNHTEDAFYLRQLKRCLMQSLAEFRPDVVIYNAGTDVLEGDPLGNLAISAEGVMERDR
LVFSTFRTLGIPVVMLLSGGYLKASAGVIAASIVNLRLQGLLN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgactgaccgagcgagtgcatcacgaggagcaggagtcggaagaggtggtctgg
gtcaagagggaggacgcacgcatcgccggcaagctgcccatcgtattctcgaggaactat
gcggtccgctttggtggccttgaacgcctacatcccttcgatgcggccaagggcaagcac
attcacaagctcctgtgcgcccagctgcagctcgacgagggcagcttctacgagcccacg
gagctgaccaagaaccagctgcgtcggattcacacaaggggctaccttaagtcactgcgc
tggagcatgaatgtggcctgcatcgctgaggtgccggtaatggcctttgttccgaatcgc
tacattcagcgctcctatttgcgtcccatgcgcttccaagcagccggttccattttggcc
ggcaggctggcgttggattatggctgggccatcaacctgggcggtgggttccatcactgc
tgctcgtacagaggcggtggcttctgtccgtacgctgacatctcgctgctcatcgtcagg
ctgttcgagcaggaaccataccgggtgcgccgcatcatgatcgtggacctggatgcccat
cagggcaacgggcacgagcgggacttcaacaacgtggcagccgtgtacattctggacatg
tacaatgcctttgtctatccgcgggatcatgtggccaaggagagtatccggtgtgcggtg
gagctgcgcaaccacactgaggatgccttctacttgcgacaacttaaacgctgcctgatg
cagtccctggccgagttccgtccagatgtggtcatctacaatgcgggaaccgatgtcctc
gagggggatcctttgggcaatctggctatttccgcggagggcgtcatggagcgggatcga
ttggtgtttagtacattccgcactttgggaattccggtggtaatgctgctcagtggtggc
tacctaaaggcatccgcgggcgtaattgcggcttccattgttaatctgcggcttcaggga
ttgctaaactaa

DBGET integrated database retrieval system