KEGG   Drosophila yakuba: Dyak_GE10782Help
Entry
Dyak_GE10782      CDS       T01068                                 

Definition
GE10782 gene product from transcript GE10782-RA
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dya  Drosophila yakuba
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dyak_GE10782
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Dyak_GE10782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 475 aa AA seqDB search
MTTAVLGGGLSGLSAGYYLLRRFGKPLTIYEASPRVGGWVRSENRKDRNFIFESGPRTIR
PVGLPGANTLELVEELKLEVTPIRRSHVAARNRMLYAKGQLCMLPNSPKGLFGVLPPFTK
PLYKAVLRDLVTASKKAKLEDESIYSFAERRFGKEIADYAISPMICGICAGDAREISVRF
LMEGLFEKEQKYGGVLKGALISRFEKNKTKDTKDGLFAERQPKLYAQALKQKWAMYGLQG
GLENLPKAMRKYLGERDVNVQLSNECRNLTFSSTGVRMNIKDAEVPVEHVVSSLPAYKLA
PLVKQQHPSLSAQLLSIPYVDVLVVNMQFPGKLLKQDGFGLLVPPVEKLPLLGVIFDSCC
FDMGENTVLTVMMGGHWFDQWFGDRPSPKQILDLATSHVQKMLQIREEPKFSRVHTLHKC
IPQYTVGHKRRVEAIRNYIKTYKLPLSVCGAAYDGVGINDVILSARRQVEAIPLS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggccgtgctgggaggcggattgagtggactgtccgcgggatactacctgttg
cggcgattcgggaagccgctgaccatctacgaggcctcgccccgtgtgggcggttgggtg
cggtcggagaatcgcaaggatcgcaacttcatcttcgagagcggtccgcgaaccatacgc
cccgttggcctgccaggcgccaatacgctggaactggtggaggagctgaaactggaggtg
acgcccattcgtcgcagtcatgtggcagcgcgcaaccgaatgctgtatgccaagggacag
ctgtgcatgctgcccaacagtcccaaaggtctcttcggcgtcctgcctcccttcacgaag
ccgctgtacaaagcggtgctccgggatctggtcacagcaagcaagaaggccaagctggag
gatgagagcatctatagcttcgcagagcgcaggtttggcaaggagatagccgactatgcc
atcagtcccatgatctgcggtatttgcgccggagatgcgcgtgaaataagcgtgcgcttt
ctgatggagggactctttgaaaaggagcagaagtatggaggagtgcttaagggcgcactc
atttcccgctttgaaaagaacaagaccaaggacaccaaggatggactatttgccgagaga
cagcccaagctgtatgcacaggcgctaaagcagaagtgggccatgtacggactgcaaggc
ggactggagaacctgcccaaagctatgcgaaagtatctgggcgagcgggatgtcaacgtg
cagctaagcaacgagtgccggaatctgaccttcagcagcactggagttcgaatgaacatc
aaggatgccgaagtgccggtggaacatgtggtcagctcccttcctgcctacaaactggcg
cctctggtgaagcagcagcatccctcgctgagcgcccagcttttgagcattccgtacgtg
gatgtgctggtagtgaacatgcagttcccgggcaagctactcaagcaggacggatttgga
ttgctagtgccgccagtggagaagttgcctctactgggcgttatcttcgacagctgctgc
ttcgacatgggcgagaacactgtgcttaccgtgatgatgggtggacattggttcgaccag
tggttcggcgatcgtcccagtcccaaacagatccttgacttggccaccagccatgtgcag
aaaatgctgcagatccgcgaggaacccaaattcagtcgagtgcacacgctgcacaagtgc
atcccacagtacactgtgggccacaagcggcgcgtagaggccatccggaactacatcaag
acttacaaactgccactgtctgtctgcggagctgcctacgacggcgtgggcatcaacgat
gtcatcctgtccgcccggcgacaggtggaggccatacccctgtcctaa

DBGET integrated database retrieval system