KEGG   Drosophila yakuba: Dyak_GE10785Help
Entry
Dyak_GE10785      CDS       T01068                                 

Definition
GE10785 gene product from transcript GE10785-RA
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dyak_GE10785
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE10785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 3947 aa AA seqDB search
MCEVCADFQNLLELYEVRVASSDLKFQLLLKSEIETTFNYIQSWPQRQCMCLYRDTKNYD
RFNLVVQSLICLTVQHLKHIDHLIDNYKRLTASAAQVVAQAQQQREQQRDEASAQAEGKD
SSTPAEETKKEEPSESSSEEAQGSGDGPAKKPPVGPCTPPPPQTANPQHKSHLQYTEEPW
ILPEVEKLLVLVSKVFLLNFPLYIAHKHGMHSRLDDLQAEEAHHLALICDLHDNDLPIYL
LRNVSLFCNSGGFGAMSLCFEHPDLPVSTAHSMTAAVSNVKLWLNYHCNTQLFVPLRSRI
LQYMCKLSDQSLRSAATRAMADFVWSSMRDPLDVAVNFDTEGLALAFKYFTSTTLTMRLA
GMAQINAHINLFNEICTTETVNEVELFGQRIANWLTENHIVQHLFGPNLHVEIVKQAHVL
LNFLAVENQISEEDIKLIWQATQLKHCSKTIFDILPSLVKNLAPRPAMHLYSLLCRMDPK
EHTEQSIYIASALTKLLWTRDCSRSQMNLMQDHLLGSNVTASSSDSGSIEGSNTEDDHVG
ADDSSIASGGGGGGVGNKSPIDGVTPCKQARHRRHICDPTTEKGKQISPEDMGKVDMVNN
RIVNIIDNTSSEEELQSRAALELQLHRSRKKTSNKRRRQKANKQIILPHELVEIWDGGED
VPSSDEADGEADGDGDGELIADSDECSDGATSQLVPAAVLKHLQGEGPYIRAIETNINEL
LSGAENDGSYSSPMSNKSEKNLADFDDEDVSPCEEELAQLVSSRANCPDVPPAFAAAAAA
MMVAQSAMALQKSGESNVAAAAAAVAAAAAATGTAQQTLVAMNRQASVAAAAAVVAAAKA
KSDSDVDLMEVASGGKQHHSPKASQSSSTSGSTPVQPSFKLNDVCQPGNTLLWDLLQDDK
IGQLGESLALEAEKALATLLCFSMDRQLRTKFIEGCLYNVANNRSVIVSLRLLPKLFASF
QQFRPSDTHSMTLWAERNHRMMQCFFNNIRHYARRHAEVLITQNGEQQQQQQLGGQLYSH
KTQVSVRLQFLSSIFSTVGSPKSFRLTLEQLDALWEWLAHDPECADCYFSWLQAQAKGGD
QHALGIEALQHLYLKKLPELRPEEFSMVALGLFQQLCSFARIAMAEYDKHSEQISASASA
VGMYHLWKIALRAQSNDVSLAAIQYINMYYMGQQLRLEKEFVSQCMENLVQAATALESID
DETALMRVQRGLLLLNTHLDTFRRRYAFHLRRWAIEGKGIGSHSNLKNEGAGPPLRIVLQ
QAGLSEKSLLQMHACDLIADLKAEVSKWWESLQTGLAAPVLGLLLSDGPLRIITQGQELT
SDYDERSLGDAGFKDNQIVYVSLGGRGARRKESNLEHPSMLPPPPKECLPTVLLLQPKYF
EKLFCLMQTLGDMQPQASTVNPQHHTKAQLLSRRVWDILAMLPTNPHILDAFKSLVTDLS
ELEQMDAAGEEEQLATKRKQIKQKFRDLLDPNNLQKFMYSLHIVESLALTSSRRGESNGN
AAMGHPPEQVRVKKSSMGRRRNSNEQPPPPPPEVKLSKEQLCELEAPLTPTPSTGLQDVE
TEASSSSGGDKENQPKQHSKRQKKGDTFEQEKERPVGCSTPPSPTPPPPALSVMERGDNK
WSEAFVKCGGLRHLYEIFSEGQLQQSAHPKELALNEWRHDCLASLLRILWLLGFEELQSA
DAHVLMSRPHPFMLQLMEVPECLTRLSSILNDEVHQQHQASSANPLVFPYQFQHLRTGFW
GRAQLIQFAMNILVSFVHASAEARRLLWAPTGTDHCRWLQKFILEDPEPAVRREICAGLY
RICLGNAHSYRLLLAPLLHKLIALLPLAEQMSSGTQPTQFLLSEEGKDPYGPACRDYFWL
LARLVDTLSPEMVAEEHIDIEMLCESISQSILTREYYELRHGYQDDGLVGLLNLMSNLIK
YDTTFKYTPKALSFIEQLIGFLFDMPSPADRQKPKCKSASSRASAYDLLVELCRGCATNY
AYLHGRLLAQHKSGPKQPYPWDYWPRDEGRSECGYVGLTNLGATCYMASCVQHLYMMPQA
RAAVLRVPPTAARKHGPTLLELQRMFAYLLESERKSYNPRSFCRVYQMDHQPLNTGEQKD
MAEFFIDLVSKLEDMTPDLKHLVKRLFCGSLSNNVVSLDCGHVSRTAEDFYTVRCQVADM
RNLQESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTM
LKEKVNTHFSFPLRLNMCHYVEKTLMPQQYKEERERRQRENEGADGAGDGNDNEKAEATL
DADIEECYEYELVGVTVHTGTADGGHYYSFIKERTKTSYHPHERWFLFNDAEVKPFDPSQ
IAAECFGGEMTSKTYDSVTEKYLDFSFEKTNSAYMLFYERRLPEHLQRRHSELLVTPTPS
PTVEEKSEAEEPTKMETSASEIKADVDVEVEDEEKDKENPAKTDTESKESPAKEEVAEAE
AKQDEPEKNESDSQSIDGEKKSETDKKPAEKTIVGTEEEKQPTANCDNHKPSNNSHNKAS
NDQQPSTSKAAQKLQLFRPLLNKDLEDWIWQDNRQFLQDRNIFEHTYFNFMWQICGHIPQ
SLISETDVTCMAAKLSVSFFIETFIHAKEKPTMVPWVELLTKQFNASQEACEWFLSHMSL
EPYWPVQVLIQCPNQMVRQMFQRLVIHVIQQLRASHADLYLDVETDEDDKELIGQASCVT
RFIGSLISLLEHGARANLRHLSEYFGLLCEFSRMGDEEAMYLLRIGILKSLVDFYLGHKQ
TDSIDISSDNEDNSSDEALSVEKMRPASLDKMIALCASLVERSRGPDFRLRLSPKDFTAI
AGGKGFPFLYQQIKDGINPHQTKHLIHALCRWDERLATQIIGMLFASVTKHTELCAPFFK
LLTLLTETQGGPVGLPCFTQLILPRMWDAAEYCPQSVLDWLSLQATKNKIAHAWILQSAE
KWLEQFLLAHDNTRVRNAAAFLLVALVPSQPFRANFRAHSQHKLLALNPHSYRDINSDAQ
AVLHQVITLLLRLLRPARVYADIGAHGTTKLTAYFNLLSYCMVSKTEKLMIGSYMRSLWE
LFHPRLSEPSVPAHHNKHALLTFWHHSLVDCPENAAQVANCPEITRNIAFNYILADHDDA
EIVTYNRSMLPAYYGLLRLCCEQSRALTRQLSQHQNLQWAFKNITPHPTQYAAAVDELFK
LMALFATRHPDASEQEKLDVTQFRRAVIVSYTSSLDARVSWSTLISALKILVDNEEDRTM
VIFNGGIEMCFEALHTLHSMHHEATACHVAGDLFDLLGEMLLLLATLRTRTDSPAQKKQQ
QQQQQLEQQLQLQQQQMLQKQQQQSQSQTQTPQTPQQKEKQLQQQMQQHLQLQQLQQMQF
QQQHFLRQQHQHSALAKALPDAVKRLATLLNTFNSPEISRMALEVLKELVRNPSLETISI
LAPILINCHLSVANAPNAIGPLGPYFPRRGAKHTPWPLGAKNSPRPPRPMVQMCIALAEL
TPRGLDADYDVQVESFYRPYHDFIDVMMRMCVNTGTLNDTLVKLQCLVAIESTPLHFTYF
PKFWVGIHNNALTHKYVELLVKNQLLVEYLHNVLRDERSMLKDACVREFLELYYHKVAAQ
LPVARMIYTINYGMHSKDDIDELCGDLFAIRIIAQATGVPASVRKELRGSLRALQNKSER
FKKESERDPFPNKKQKRDSQKVKEKDQAQSEGEKETSTDNDKPADVSMESSGNSEQVTDS
TKPPTPAGSDDEQMEKTSIPSSDDETELEDELQPTPKRNKKASNKKTAQDRLNEEREKRL
ITLITMESYIQSIFAILKRDASVPSSGPTKEPSEEPCGEASTSAAAAVKLSRPKGACTPP
EPMADANDTRCKMDTETEAEEQSPKPSHTNGSQQNESPPAANSADSATANPSPAPAAAVA
STPSSXXXXRCVHVPGSESNTDLVVIQRFAQHFVFRQATGLIMGAIG
NT seq 11844 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgaggtgtgcgccgacttccagaatctcctggagctgtatgaggtgcgcgtggcc
agctcggatctcaagttccagttgctgctgaagagcgagatcgagaccaccttcaactac
atccagtcctggccgcagcgtcagtgcatgtgcctgtaccgggacaccaagaactatgac
cgcttcaatctggttgtgcagtcgctcatctgtctgacggtgcagcatctgaagcacatc
gaccacctcatcgacaactacaagcggctaacggccagtgctgcccaggtggtggcccag
gcccaacagcagcgagagcagcagcgtgacgaggcgtcagcccaggcagagggaaaggat
tcatccacaccagcggaagaaaccaagaaggaggagccatctgaatcctccagtgaggag
gctcagggctccggcgatgggccagccaagaagccgccagttggcccctgcactccccct
cctccgcaaacagccaatccgcagcacaaatcccacctgcagtacacagaggagccatgg
atcctgcccgaggtggagaaactactggtgctcgtctcaaaggtgttcctgctcaacttc
ccgctgtacatcgcccacaagcatggcatgcactctcggctggacgacctgcaggctgag
gaggcccaccacctggccctcatctgcgatcttcatgacaacgacctgcccatctacctg
ctgcggaatgtgagcctcttctgcaactcgggcggctttggcgccatgtcgctgtgcttc
gagcaccccgatctgccggtgtccaccgctcactcgatgactgcggccgtctcgaatgtg
aaactttggctgaactatcactgtaatacccagctcttcgtgccgctgcgcagccggata
ctgcagtacatgtgcaagctgtcggatcagagcctccgatctgccgccacccgcgcgatg
gccgactttgtgtggtcttctatgcgggacccgctggacgtggcagttaacttcgatacc
gaaggattggcactggcctttaagtacttcacatcgaccacgctgaccatgcgactggca
ggcatggcccagatcaacgcacacattaatctatttaatgagatctgcaccaccgaaacc
gtcaacgaagtggagctcttcggacaacgcatcgcgaactggttgactgaaaaccacatt
gtgcagcatctgtttggcccgaatctgcacgtagagatcgttaaacaggcacacgttctg
ctcaactttttggcggtggagaaccagatctccgaagaagacatcaagctgatctggcaa
gccactcagctgaagcactgctcaaagacgatcttcgacatcctgccctcgctggtgaag
aacctggccccgcgcccggccatgcacctttactcgctcctttgccgcatggatcccaag
gagcacactgagcagagcatatacatcgcctcagcactcacaaaactgctgtggactcgt
gattgctcgcgcagccagatgaacctgatgcaagaccacctgctgggttccaacgtcacc
gcatccagctctgacagcggcagcattgagggcagcaacacagaggacgaccacgtgggc
gccgacgacagtagcattgccagcggtggaggcggcggaggtgtcggtaacaagagtcca
atcgacggagttactccatgcaagcaggcccggcacaggcggcacatctgtgatcccacc
accgagaagggaaagcagataagccccgaggatatgggcaaagtggacatggtaaacaac
cgcattgtgaacattatcgacaacacaagcagcgaagaggagctgcaatcgcgggctgcc
ttggagctgcaactgcatcgcagccgcaaaaagacgagcaacaaacgacgtcgccaaaag
gccaataagcagattattctgccccatgagctggtcgagatctgggacggaggtgaagat
gtgcccagcagtgacgaggcagatggcgaagccgatggtgatggcgacggcgagcttata
gcggacagcgacgagtgcagcgatggcgcaacgagtcagctggtgcccgctgcggtgcta
aagcatttgcagggagagggaccctatattagggccattgagaccaatatcaatgagctg
ctcagtggcgcggaaaacgatggcagctactcctcccctatgagcaacaaatccgagaag
aacctggctgattttgatgacgaggacgtgtcgccctgcgaagaggagctggcccagctg
gtcagctcacgcgccaattgtccggacgttccaccagcctttgcagctgcggccgccgcc
atgatggtggcccagtcggcgatggcccttcagaagtctggcgaatcgaatgtggctgct
gctgccgccgctgtagccgctgccgcggcggctaccggcactgcgcagcaaacgctggtg
gcgatgaaccggcaggccagcgttgctgcagccgccgccgttgttgctgccgccaaggca
aagtcggactctgatgtggatctgatggaggtggcttccggcgggaaacagcaccactcg
ccaaaggcaagtcagagcagctctacgtccgggagtacaccggtgcagccctccttcaag
ttaaatgatgtgtgccaacccggaaacacactgctctgggatctgcttcaagacgataaa
attggtcaactgggagaatcactggctttggaggcggagaaagctctggcaactctcctg
tgcttcagcatggaccgccaactgcgaacgaaattcatcgagggttgcctgtataacgtc
gccaacaaccggagcgttattgtcagtctgcgactgctgcccaaactgttcgcctcgttc
caacagttccgaccctcggacacgcactcgatgacgctgtgggcagagcgaaatcaccgg
atgatgcagtgctttttcaataatatacgccactatgcacgtcgccatgccgaggtactg
atcacccaaaacggagagcaacagcagcagcagcagctgggcggacaactttactcacat
aagacacaagtttctgtaagactgcagttcctatcgtcgatattctcgacggtgggatcc
ccgaaaagcttccgcctaacgctggagcagcttgacgcgctatgggagtggctggcccac
gatccggagtgtgccgactgctacttttcgtggctgcaggcacaggccaaaggcggtgac
cagcacgctctgggcattgaagcactgcagcatttatatttgaagaaactcccagagttg
cgacccgaggagttctccatggttgcgttgggactcttccaacagctatgcagtttcgcc
cgcatcgccatggccgagtacgacaagcacagcgagcagatctcggcaagcgccagtgcc
gttggcatgtaccatctgtggaagatcgcattgcgcgcccagagcaacgatgtctccttg
gcggccatacagtacatcaacatgtattacatgggtcaacaattgcgcctggagaaggaa
ttcgtttcccagtgcatggaaaacctagttcaagcagcaacggctttggaaagcatcgat
gatgagactgctttgatgcgcgtccagcgtgggctgctgctgcttaacacccatttggat
acattccggcggcgatatgcgtttcatctacgccgctgggccatcgagggcaaagggatt
ggatcgcatagtaatctaaaaaatgagggagcgggtccacctctacggatcgtcctacaa
caggcaggactttcggaaaagagtctattgcagatgcacgcgtgtgacttaattgccgac
ctcaaggcggaggtgtccaagtggtgggagagcctacaaactggactggctgctcctgtg
ctcggtctgctgctcagcgatggaccgctacgcataatcacgcagggacaggagctgact
tcggattacgatgaacggagtctcggcgatgctggattcaaggataatcagatcgtctac
gtgtccttgggtggacgtggagccaggcgaaaggagtccaatttggagcacccgtcaatg
ctgccaccaccaccgaaagagtgtttgcccacagtgctcctgctgcagccaaagtacttc
gagaagctattctgcctgatgcagacactgggagatatgcaaccacaagcgtcgactgta
aatccgcagcatcacacaaaggcgcaattgctctcacgacgcgtatgggatattctcgcc
atgctgccaaccaatccgcacattctggacgcctttaagagtctggttacggacctaagc
gaactcgagcagatggatgctgccggagaggaggaacaactggcaaccaagcgcaagcag
atcaagcaaaagttcagagatcttctcgacccaaacaacctgcaaaagttcatgtactcg
cttcatattgtggagagtctggccctaactagttccagacgcggcgaatccaacggcaat
gcggccatgggacatccaccggaacaggtacgagtgaagaaatcctcgatgggaagacgg
agaaatagcaacgagcagccacctccaccgccgccagaagtcaagctgagcaaggagcaa
ctgtgcgagctggaggccccactgacgcccacaccctccactggcttgcaggatgtggaa
acggaggccagcagcagcagcggtggcgataaggaaaaccaaccgaagcaacacagcaag
cgtcagaagaagggcgacacttttgaacaggaaaaggagcgcccagtgggttgttccacc
ccaccgtctccaacccctccaccaccagcactttcggtgatggaaagaggtgacaataag
tggagtgaggcgttcgtcaaatgtggtggtcttcgtcatctgtacgaaatcttcagtgag
ggtcagcttcagcaaagcgcacatcccaaggagctggctctaaatgaatggcggcacgat
tgcctggccagcctactgcgcatcctctggcttctgggattcgaggagctgcagtcggcg
gatgcccatgtcctgatgtcacgtccgcacccgttcatgctacagttgatggaggtacca
gagtgtctgacccgactctcatcgatccttaatgacgaagttcaccagcagcatcaggct
tcttcggccaacccactggtgttcccctatcagttccagcacttgcgcaccggcttttgg
ggccgggcgcagctcatccagttcgctatgaacatcctagtgagttttgtgcacgcctcg
gcggaagcaagaaggcttctctgggcgccaactggaaccgatcactgtcgatggctgcag
aagttcatcctggaggatcccgagcctgcggtgcggcgtgagatatgcgctggcctttac
cgcatttgcttaggcaacgcacacagctatcgccttttgttggcaccactgctgcacaag
ctcatcgccctgttgccattggccgagcagatgagctccggcacccagcccacgcagttt
ttgctctctgaggagggcaaggatccctacggacccgcctgccgggattacttttggctg
ctggccagattggtggacactctctcaccggaaatggtggccgaggagcacatcgacatt
gaaatgctgtgcgaaagcatctcgcaaagcattctcacccgagagtattatgaactgcgc
catggttaccaggacgatggcttggtgggtctcttgaatctcatgtccaatttgatcaag
tacgacaccacattcaagtacacccccaaggcgttatcctttattgagcagctgattggc
ttcctgtttgacatgccctcgccggcagatcgccagaagcccaagtgcaagtcggcgtcg
tctcgagcatctgcctacgatcttctggttgaactgtgccgcggttgcgccacaaactat
gcgtatctgcatggacgtcttctggcacagcacaagtccggacccaagcagccgtatccc
tgggactattggccgcgagatgaaggcagatctgagtgcggctatgtggggctgactaat
ttgggcgccacttgttacatggcctcttgcgtccagcacttgtacatgatgccacaggcg
cgagcagctgttttgcgagtgccacccacggctgcccgtaagcatggacccacgcttctg
gagctgcaacggatgtttgcctacctactggagtcggaacggaagtcgtacaatccgcga
agcttctgtcgggtgtaccagatggatcaccagccgctgaatacgggagagcaaaaggat
atggccgagttctttatcgatttggtgtccaagctggaagatatgacgcctgacttgaag
cacctggttaaaaggctcttctgtggttccttgagcaacaatgtcgtctccctggattgc
ggtcacgtttcccgcacggctgaggacttttacacggtccgctgccaggttgcagatatg
cgcaatctgcaggaatccctggacgaagtcaccgttaaggatacactggagggcgacaac
atgtacacctgctcgcagtgcggcaagaaagtacgagctgagaagcgggcttgcttcaag
aagcttccccagatcttgtgcttcaacaccatgcgctacacctttaacatggtcaccatg
ctgaaggagaaggtcaacacgcacttctcctttccgctgcgcctcaacatgtgtcattat
gtggagaagaccttgatgccgcagcagtacaaggaggagcgcgagaggcgccaacgtgag
aacgaaggcgcagacggtgcaggcgatgggaacgacaacgaaaaggcagaggccactctt
gatgccgatattgaagaatgctacgagtacgaactggtgggcgtcactgtccacacgggc
actgcggatggcggccactactacagctttatcaaggagcgcacgaagaccagctaccat
ccacacgagcgctggttcctgttcaacgatgccgaagtgaagcccttcgatccctcacag
atagcggcggaatgctttggcggcgagatgacgagcaaaacctacgactcagtgacggag
aaatatctggactttagtttcgagaaaaccaactctgcctacatgctgttctacgagcgc
cgactgccagagcatctgcagcgccggcattccgagctgctggttacacccacgcccagt
ccgactgtggaagagaaatccgaggcggaggagcccactaaaatggagacgagcgccagc
gagatcaaggcagatgtagatgtggaagtggaagatgaggagaaagacaaggaaaatcct
gcgaagactgacacagagtccaaggaatcgcctgcaaaagaagaggtcgcggaggccgaa
gcgaagcaggatgagcctgagaaaaatgaaagcgattcgcaatcaatagatggcgaaaag
aaatcggagacggacaaaaagcccgcggagaagacgatcgtgggcaccgaggaggagaag
cagccaacagccaattgtgataatcataagccaagcaacaatagccacaacaaagccagc
aacgatcagcagccttccacgtcgaaggctgcccagaagctacaactatttcgtccattg
ttgaacaaggacctcgaggattggatttggcaggacaatagacagttcctgcaggatcgc
aacatcttcgagcacacctacttcaacttcatgtggcagatatgtgggcacataccgcaa
tcattaatatcggagacggacgtcacctgcatggcagccaagttgtctgtgtcctttttc
attgagacctttattcatgccaaggaaaagcccacaatggtgccctgggtggagctgctg
accaagcagttcaatgccagccaggaggcctgcgagtggttcctgtcgcacatgtcgctg
gagccctactggccggtccaggtgctaatccagtgccccaaccaaatggtgcgtcaaatg
ttccaacgtttggttatccatgtcatccagcaattacgtgcctcacatgccgatctgtat
ctggatgtggagacagacgaagatgacaaggagttaataggccaagcctcttgtgtaacc
cgtttcattggttcgctcatctcgctcctggagcacggtgcccgagcgaacctgcggcac
ttgtccgagtactttggactgctgtgcgagttctcacgcatgggagatgaggaggccatg
tacttgctgcgcatcggtatactcaagagcctggtggacttctatctgggacacaagcaa
acagatagcatagacataagctccgacaacgaagacaactcctctgacgaggcgctgtcc
gtggagaagatgcgtccggcctcgctggacaaaatgattgctctgtgcgccagcctagtg
gaaagatcaaggggacccgacttccgactgcgactctcgcccaaagacttcactgcaatc
gccggcggcaagggttttccatttttgtaccaacaaataaaggacggcattaatccgcac
cagacaaagcatttaatacacgccctttgtcgctgggatgagcgcctggccacgcagatc
attggcatgctattcgcctcggtaaccaagcacacggagctgtgcgcgccattcttcaag
ttgctcaccctgctcaccgagacgcagggcggtccagtgggcctgccttgtttcacccag
ttaatcctgcctcgaatgtgggacgcggccgagtactgtccacagtccgtgctcgactgg
ctctcgctgcaggccaccaagaacaagatcgcccacgcctggatccttcagtcggccgag
aagtggctcgagcagttcctgctggcccacgataacactcgtgttcggaacgctgccgcc
tttctgctggtggcactggtaccctcccagccgttccgggccaacttccgcgcccactcg
caacacaagctgctggccctcaatccacacagttatcgcgacataaacagcgatgcccag
gcggtgctgcaccaggtgattacgctgctcctgcgattgctgcgtccggcgcgcgtctat
gcggacatcggagcccatggcacaaccaagctgaccgcgtacttcaatctgctcagctat
tgtatggtttcaaagactgaaaaactaatgataggatcgtacatgcgctccctgtgggag
ctgtttcatccacgcctctcggagcccagtgttccagcccatcacaacaagcacgcacta
ttaaccttctggcaccactcgctcgtggactgtccggagaacgctgcccaggtggccaac
tgcccggagatcacgcgcaacattgcatttaactatatactggccgatcatgatgacgcg
gagatagtcacctacaatcgttccatgctgcccgcctattatggactcctacgtctgtgc
tgcgagcagagccgagcactcacccgccaattgtcccagcaccagaacctgcagtgggcc
ttcaaaaacatcacgccacatcccacgcagtatgcggcagccgtagacgagctcttcaag
ttgatggctctgttcgccacccgtcatccggatgccagtgaacaggaaaagctcgatgtg
acccagtttaggcgggctgtgattgtgtcctacaccagtagtctggatgcacgtgtctcc
tggtccacgctgatcagtgctctcaagatacttgtggacaatgaggaggaccgcacgatg
gtgatcttcaacggcggcattgagatgtgctttgaggcgctgcacacgctacattccatg
catcacgaggccaccgcctgccatgtcgcaggagacctatttgatctcttgggcgagatg
ctgctcctcctagccacgctgcgaacgcgcacagacagtcctgcgcaaaagaagcagcag
caacaacagcagcagctggagcaacagttgcagttgcagcagcaacagatgctgcagaaa
cagcagcagcagtcgcaaagccaaacgcaaacaccgcagacgccgcagcaaaaggaaaag
cagctgcagcaacaaatgcagcagcatctgcagctgcaacagttgcagcaaatgcaattc
cagcagcagcacttcctgcgccagcagcatcagcactcggcgctggcaaaggcactgccg
gatgcagtgaaacgactggccacgctactcaacacctttaattcgccggagatcagtcgc
atggccttggaggtgctcaaggagctggtgcgcaaccccagcctggaaaccattagcatt
ctggcgcccattcttatcaactgtcatctgtccgtggcgaatgctcccaatgcgatcggt
cctctgggaccgtacttcccgcgtcgcggagcaaagcatacgccttggccattgggcgcc
aagaactcaccccgtccaccgcgacccatggtacagatgtgcatcgctctggcagagctg
acacctcgtggtctggatgcggattacgacgtccaggtggagtccttctaccgaccatac
catgactttatcgatgtcatgatgcgcatgtgcgtcaacacgggcactctgaacgacacg
ctagtcaagctgcaatgcttggtggccatcgagtccacgccgctgcacttcacctatttc
cccaagttctgggtgggcatacacaacaatgctctgacgcacaaatacgttgaactgctc
gtgaagaatcaactgttggtggagtacctccacaatgtcctgagggacgagcgaagcatg
ttaaaggatgcgtgtgttcgcgaatttctggagctctactatcacaaggttgccgcccag
ctgccagtggcccgtatgatctacacaatcaactatggtatgcactccaaggacgacatt
gacgagctgtgtggcgatctgttcgccatccgaatcattgcccaggccactggagtgccg
gcctcagtgcgcaaggagttgcgaggttctttgagggcacttcaaaacaagagcgagcgg
tttaaaaaggaatcggagcgggatccatttccgaacaagaagcagaaacgtgactcgcaa
aaggtcaaggaaaaggatcaagcgcagtcggagggcgagaaggaaacctcaacggacaac
gacaaaccagcagatgtctctatggaatccagcggcaactcggagcaagtaacagacagc
accaaaccaccaactcctgcaggcagcgacgatgagcagatggagaaaacgtcaattccc
tcgtccgatgacgagacagagctggaggacgagctgcagccgacgcccaagcgcaacaag
aaggcgtcgaacaagaagactgcccaggatcgtctcaatgaggagcgcgaaaagcgactt
atcacgctgatcaccatggaatcctacatccagagcattttcgccatccttaagcgcgat
gccagtgtccccagttcggggccaactaaggaaccaagtgaggaaccgtgtggcgaggcg
tccacttcagcggcagccgctgtaaagttgtctcgccccaaaggcgcctgcactccgccg
gagccgatggccgatgcaaacgatacgcggtgcaagatggatacggagacagaggcggag
gagcaatctccgaagccgagccacacgaatggtagccaacagaacgaatccccgccagcg
gccaacagtgcagacagtgcaacagcgaatccttcacccgctcccgcggccgccgttgcg
tccactcccagcagcgannnnnnnnnncgttgcgtccacgtcccaggcagcgagtccaac
acagatttagttgtcattcaacgatttgctcagcattttgtttttcggcaagccactgga
ctgataatgggcgccatcggctga

DBGET integrated database retrieval system