KEGG   Drosophila yakuba: Dyak_GE10824Help
Entry
Dyak_GE10824      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dya  Drosophila yakuba
Pathway
dya04013  MAPK signaling pathway - fly
dya04068  FoxO signaling pathway
dya04624  Toll and Imd signaling pathway
dya04933  AGE-RAGE signaling pathway in diabetic complications
Module
dya_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dyak_GE10824
   04068 FoxO signaling pathway
    Dyak_GE10824
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dyak_GE10824
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dyak_GE10824
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dyak_GE10824
Protein kinases [BR:dya01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dyak_GE10824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 6538770
NCBI-ProteinID: XP_002099284
FlyBase: FBpp0255834 FBgn0228664
UniProt: B4PL11
Position
3R
AA seq 366 aa AA seqDB search
MSASVTKKFHKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKALVRGTTMHVAIKKLARPF
QSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHAANASLENFQQVYLVTHLMDADLNNI
IRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTE
NEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPADFLKKISSESARSYIQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKR
ITAEEALAHPYLEKYAEPSGEQTSPPYDHSFEDMDLPVDKWKELIYKEVTNFKPPPSFAQ
VLKDVK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgtccgtaacaaaaaagtttcacaagttggatataaaccgaacggaatgggag
ataccggatatatatcaggatctgcagcccgtgggatcgggtgcttacggtcaggtgtcg
aaggcacttgttcgtggcaccaccatgcatgtggccattaaaaagctagcaaggcccttt
caatccgccgtccatgcaaagaggacgtatcgggagcttcgactgttaaagcacatggat
catgagaacgtaattggtctgctggacatattccatccacatgccgctaatgcatcgctg
gagaacttccaacaggtgtacttggttacccacttgatggacgcagatctgaacaacatt
atacggatgcagcacctgtccgatgaccacgtccagtttttggtctaccagatacttcgt
ggcttgaagtatatccacagcgcgggagtgatccaccgagatcttaaaccctccaacatt
gccgtcaacgaagattgcgagctgcgcattctggatttcgggctggcacgtccaacggag
aacgagatgacgggttatgtggccacgcgttggtatcgcgctcctgaaataatgctcaat
tggatgcactacgaccagacggtggacatctggtcggtggggtgcatcatggccgaacta
attacccgacgcactctcttcccaggcaccgatcatatccaccagttgaacctgattatg
gagatgttgggcacgccacccgccgactttttaaagaagatctcatcggaaagtgcacgt
tcctacatccagtcacttccgcccatgaaggggcgcagtttcaaaaatgtttttaagaac
gccaatccgctggccatcgatttgctggagaagatgctggagttggatgccgagaagcgg
atcacagccgaggaggctcttgcccatccctatctggagaagtatgcagagcccagcggg
gagcagacctcaccaccatacgatcacagctttgaggatatggatttgcccgtggacaag
tggaaggagctgatctacaaggaggtcaccaactttaagcctccaccatcgtttgctcag
gttctaaaggatgtcaagtaa

DBGET integrated database retrieval system