KEGG   Drosophila yakuba: Dyak_GE11327Help
Entry
Dyak_GE11327      CDS       T01068                                 

Definition
GE11327 gene product from transcript GE11327-RA
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dya  Drosophila yakuba
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dyak_GE11327
   04350 TGF-beta signaling pathway
    Dyak_GE11327
   04068 FoxO signaling pathway
    Dyak_GE11327
   04150 mTOR signaling pathway
    Dyak_GE11327
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dyak_GE11327
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dyak_GE11327
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dyak_GE11327
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dyak_GE11327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 376 aa AA seqDB search
MEEFNSNGSVVNGTGSMEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTVT
NQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCL
METDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICD
FGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDMWSVGCILAEMLSNRPI
FPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALAL
DLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLI
FEETLKFKERQPENAL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatttaattcaaacggatcagtggttaacggtacgggatctatggaagttcct
caatctaatgctgaagttataaggggacaaatatttgaagtgggtcctaggtatattaaa
ctcgcctatataggtgaaggagcttatggaatggttgtgtctgcagatgacacggtaact
aaccaaagagttgcaataaaaaaaatatcgccgtttgaacatcaaacttactgtcaaagg
actctcagagaaataaccatattgaccagatttaaacatgaaaacattattgatattcgt
gatattcttcgggttgatagcatagaccaaatgagagatgtttatatagtacagtgttta
atggagactgatttgtataaattacttaaaacacagaggcttagtaatgatcacatctgt
tactttttatatcagatattgcgtggacttaagtatatccattcagcaaacgtcttgcat
cgggacctaaagccaagtaatttactgttaaacaagacgtgcgacctaaaaatttgcgac
tttggattggctcgtattgcagatcccgagcatgaccatactggctttctcacagaatac
gttgctactcggtggtatagagcacctgaaattatgcttaactcaaaaggatacactaaa
tcaattgacatgtggtccgttggctgcattttggctgaaatgttaagtaatcggccaata
ttccctggaaaacattatctggatcaacttaaccatattcttggcgtgttggggtcgccg
tcccgggacgatttagaatgtattattaacgaaaaggcacggaactatttggagtcttta
ccatttaagccaaatgtaccttgggcgaaacttttcccaaatgctgatgcgttggcttta
gaccttcttgggaaaatgttaacatttaacccccataaacggattcctgtcgaggaagct
cttgcacatccctatttagagcagtattatgatcctggagatgagcctgtagctgaagtg
ccatttcggattaatatggaaaatgatgacatttctcgagatgctttaaaatcattgatt
ttcgaagaaactttaaaatttaaggagcgacaaccagaaaatgcgctttag

DBGET integrated database retrieval system