KEGG   Drosophila yakuba: Dyak_GE11470Help
Entry
Dyak_GE11470      CDS       T01068                                 

Definition
GE11470 gene product from transcript GE11470-RA
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dya  Drosophila yakuba
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE11470
Enzymes [BR:dya01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Dyak_GE11470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 297 aa AA seqDB search
MATTAAAMAATSVVVLDRGNNTTCTINLHGATVVSWRVNNQEQLFVSKLASFDGKKAIRG
GIPFVFPQFGAWSFGPQHGFARITRWHLERPPDRLHNGDVEAIFSLMDNDFTRSIWNYQF
RITYRLILREKELHFHIGVYNPSKELSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKT
RENALYQEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDR
SREMSDFGDDEFPNMLCVEAGNVTSPVILLPGTAFEASQILQIIIEGNVSRKTKRNR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggccaccactgcggccgcaatggccgcaacgagtgtagttgttctggatcgcggaaac
aatacaacctgcaccatcaatttgcacggtgccacggtcgtgtcctggcgggtaaacaat
caggagcagttgtttgtcagcaaactggcctcgttcgatggcaagaaggcgatacgtggt
gggattccgtttgtctttcctcagttcggtgcctggtcctttgggccacagcatggattt
gcgaggattaccaggtggcacctggagaggccgccagacaggctgcacaatggcgatgtg
gaggccatattctcgcttatggacaatgactttacgcgatccatctggaactatcagttt
cgcatcacttatcggctgatcctgcgcgaaaaggagctgcacttccacatcggcgtctac
aatcccagcaaggagctgagcttcaccttcaacatgctgctgcacacctacctaaaggtg
cccgatgtgcggcgatgtcagatcactggcctccagggctgccacttcattgacaagacg
cgggagaatgcgctctatcaggagggacgcgaggtggtcaccgtcaatgagtggaccgac
aggatctaccagcacacgccgcaggagcacgtcatcacaaacgtggtgtccggccggaag
atgagactgcacaagtacaattttcccgacacggtcatctggaatccttggattgatcga
tcgcgtgagatgagtgacttcggggacgacgagttcccaaacatgttgtgcgtggaggcg
ggcaatgtcacgtcgccggtgatcctgctgccgggcaccgctttcgaggccagccagatc
cttcagatcatcatcgagggcaatgttagtcgcaagaccaagcggaatcgctag

DBGET integrated database retrieval system