KEGG   Drosophila yakuba: Dyak_GE11655Help
Entry
Dyak_GE11655      CDS       T01068                                 

Definition
GE11655 gene product from transcript GE11655-RA
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 510 aa AA seqDB search
MWITGQFVFLLLVALVAAKTKTSAVQDDIAEYKDFKKLLRTKNNVLALYVTSAKAAAAEL
KVFREAAEAVRGTGTMLLLDCGQQDRKKLCKKLKVSPEPYAIKHYKDGDFHKDYDRQLSV
SSMITFMRDPSGDLPWEEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKM
KPDYGKAATELKNKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGEN
NKDALVSFMLNPNAKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKDEKSALVMFYAPWC
GHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFE
VNVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDSKEVLFLDDDNFSSTLKRKKHALVMF
YAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDCTKLAALCAKYNVRGYPTILYFSYLK
TKLDYNGGRTSKDFIAYMNNPPSSADRTEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtggatcaccggtcagtttgtttttcttctgctggtggcacttgttgccgcaaaaacg
aaaacttcagcggtgcaggatgacatcgcggagtataaggacttcaagaagctgttacgc
accaagaacaatgtcctcgcgctctatgtgaccagtgcaaaggctgctgctgccgaacta
aaggtattccgggaagcggcggaggctgtacggggaaccgggacaatgttgcttctggat
tgcggacaacaggatcgcaagaaactgtgcaagaagctgaaggtctcgccggagccttac
gccatcaagcactataaggatggcgacttccacaaggactacgaccggcagctgagtgtc
agctctatgatcacttttatgcgtgatccctccggcgatctgccgtgggaggaggatcca
gccggaaaggatgtcctgcacttcagcgacgctgcttcctttacaaaacacctacgtaag
gacatccggcccatgcttgtcatgttctatgttccctggtgcggcttctgcaagaaaatg
aagccggactacggaaaagcagcaacggagctgaagaataagggcgggtatattctggcg
gcaatgaatgtggagcgacaagaaaacgctcctatacgtaaaatgttcaacataacaggt
tttcccactctgatttactttgaaaatggcaagctgcgctttacttacgagggagagaac
aataaggatgctttggtatctttcatgctcaacccaaatgctaagccgacgccaaagccc
aaggaacccgaatggtcggcggataccaattcggagattgttcacctcacctcgcagggt
tttgagccggctttgaaggacgagaagtccgccttggtcatgttctatgcaccctggtgc
ggacactgtaagcgcatgaagcctgaatacgaaaaggccgctctggaaatgaagcagaaa
aagattcctggccttttggcggcattggatgcaacgaaggagccgtcaatcgcagagaaa
tacaaagtcaagggctatccaactgttaagtttttctcaaatggcgtctttaagtttgaa
gtaaatgtccgggaagcatcgaaaattgttgaattcatgcgagatcccaaggagcctcca
ccgcctccgccacccgagaagagttgggaggaggaggaggacagcaaggaagttctattt
ctggatgacgacaactttagttcgacgctaaagagaaaaaagcatgcgctggttatgttc
tatgctccctggtgtggacactgtaagcacacaaaaccggaattcacagcggctgccacc
gccttacaggatgatcctcggatagcgtttgtcgccatcgactgcacaaagcttgccgct
ctctgcgcaaagtacaatgttcgaggatatcccaccattctgtacttctcttacctcaaa
accaagctggattacaacggcggacgcaccagcaaggactttatcgcctatatgaacaac
ccgccgagctcagcggaccgcacagagctgtga

DBGET integrated database retrieval system