KEGG   Drosophila yakuba: Dyak_GE11693Help
Entry
Dyak_GE11693      CDS       T01068                                 

Definition
GE11693 gene product from transcript GE11693-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dya  Drosophila yakuba
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dya00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 533 aa AA seqDB search
MHFSQSRWLHAILLFLLAFVGTTLSRVQEVHDVLELTGQKASKLRFSTDVATGKYTPPEE
MDPQFWYKLADEEITKRLQLPQPNSLKAKNVIMFLGDGMPLSTVTAARILKGQRQNKTGE
ESSLSFEKFPYSGLSRTYCANAQVPDSACTATAYLCGVKTNIINIGVSAAVNYNNCTASQ
DPANRLTSIAEWSQNAGKSTGIVTTTTLTHASPSGAYAKTANRMWQSDTDVTSYGVDAST
CIDMATQLVTQTPGKNFEVMFGGGMGKFLPKTMKDSHGTAGERSDGVNLLSRWQALHDKG
VLVTNRKQLLNVDVSSASSIIGTFQSGLMDFHMDADPTYQPTLSELTEVAIKKLRHNENG
YFVFIEGGLIDYGNHYTQAGYALDEALEFEKAIQLARDMTNISDTLIVVTADHGHAVSIA
GYPGRGTPILGVNQHDTDINGVKYSVLNYAAGPNQYLDESGQRIPLDDILGPDDAISPSY
IAKEIGVHSGEDVGVWASGPQSHLFTGVMQQSTIPHLMAYASCVGSGKQVCNK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcatttctcccagagccgctggctgcatgcgatccttctgttcctgctggccttcgtt
ggaaccacactcagtagagttcaggaggtgcacgatgtgttggagttgaccggccagaag
gccagcaagctcaggttttccacggacgtggccaccggcaaatatacaccgccggaggag
atggatcctcaattctggtacaagctcgccgacgaggagatcaccaagaggctgcagcta
ccacagcccaattccctaaaagccaaaaacgtgattatgttcctcggcgatggtatgcca
ctctccactgtcacagctgctcggatcctgaaaggacaacgccaaaacaaaactggagag
gagtcctcgctgagcttcgagaaattcccctattcgggattaagcagaacctactgcgcc
aacgcccaagtacccgactccgcctgcactgccaccgcctatctgtgcggcgtgaaaacc
aacatcattaatatcggagtaagtgcagcagtaaactataacaactgcaccgccagccag
gatcccgcgaaccgcctgacctccattgcggaatggtcccagaatgccggcaagtccacg
ggcattgtgaccaccaccacactgacccacgccagtccatcgggagcatatgccaagacg
gccaatcgaatgtggcagagcgacacggatgtgaccagctatggagtggatgccagcacc
tgcatcgacatggccacccagctggtgacccagacgcccggcaagaacttcgaggtcatg
ttcggcggcggaatgggcaagttcctacccaaaaccatgaaggatagtcacggaacggct
ggagagcgatccgatggtgtgaatctgttgtcccgctggcaggcactccacgacaaaggc
gtcctggtcaccaatcgcaagcagctgcttaacgtagacgtttcgtctgcctccagcata
attggtaccttccagtcgggcttgatggactttcacatggacgctgatcccacctatcag
ccaactctctcggaactcaccgaggtggccatcaagaagctcaggcataatgaaaacgga
tacttcgtgttcatagagggcggtctcattgactatggcaaccactacacccaggcgggc
tacgccttggacgaggctctggagttcgagaaggccattcagctggctcgcgacatgacc
aacatcagtgacacgttgattgtggtgacggctgatcacggacacgccgtcagcatagcc
ggttatcctggcaggggtacacccattctgggagtgaaccaacacgacacggatatcaac
ggagtgaagtactcggtgctcaactacgcggctggacccaatcagtatctggatgagagt
ggccagcgcattcctctggacgatatccttggccccgatgacgccatatcacctagctac
attgccaaggaaatcggagtgcactctggggaggatgtgggtgtttgggcatccggtccg
cagagtcaccttttcaccggagtgatgcagcagagcaccataccccacctgatggcctac
gcctcatgcgttggcagtggcaagcaggtgtgcaataaataa

DBGET integrated database retrieval system